SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218246440|ref|YP_002371811.1| from Cyanothece sp. PCC 8801

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218246440|ref|YP_002371811.1|
Domain Number 1 Region: 3-118
Classification Level Classification E-value
Superfamily RbcX-like 6.67e-44
Family RbcX-like 0.0000158
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|218246440|ref|YP_002371811.1|
Sequence length 134
Comment chaperonin family protein RbcX [Cyanothece sp. PCC 8801]
Sequence
MNCKQVAKDTARVLQNYLTYQAVRTIINQLSETNPSQALWLRQYTSSHNIQEGEVYLEEL
MNENKELVLRIMSVREHLAEAVLEFLPEMVRVGISQANMEHRRQLLTRLTQSQPVSSTPH
PEASESEVDDSFNP
Download sequence
Identical sequences B7JVW6
gi|257059482|ref|YP_003137370.1| 395962.Cyan8802_1629 41431.PCC8801_1603 WP_012594928.1.62203 WP_012594928.1.93053 gi|218246440|ref|YP_002371811.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]