SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|203287861|ref|YP_002222876.1| from Borrelia recurrentis A1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|203287861|ref|YP_002222876.1|
Domain Number 1 Region: 195-381
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 2.09e-59
Family Methylesterase CheB, C-terminal domain 0.0000093
Further Details:      
 
Domain Number 2 Region: 6-104
Classification Level Classification E-value
Superfamily CheY-like 0.000000000000645
Family CheY-related 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|203287861|ref|YP_002222876.1|
Sequence length 386
Comment protein-glutamate methylesterase [Borrelia recurrentis A1]
Sequence
MRITIYVLIIDSSSVNRKAISDIINSSSKLKVIATAANAEFALKKLKQDPDVILLGLEKE
TIKDISLIQKKQNINNKIPVIILSSNKDLAINALLQGADDFIIKIDSKLDKIKDKIIDLL
TIYGNKSIKNKIITNINCKPETYIPSQNEKDKKNNLNIINIREHNLKKTNTKYIVTSLNQ
KQIINDQDLKKLKNRKFEMVVIGISTGGPEALKIILSEISKNFPIPIVIVQHMPKGFTTE
FANNLNKICNLTVKETKNNEILQKGCIYISSGGYHTKINKINDNYQIEVFDAENVNGHKP
SIGVLFKSISENVKEKVIALIMTGMGNDGSREIGDIKKAGGVTIAQDEKSSVVFGMPKIA
IEENNIDYIVSIGHVVKLLETILLDG
Download sequence
Identical sequences B5RRM1
412418.BRE_413 WP_012538886.1.6979 gi|203287861|ref|YP_002222876.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]