SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|203287660|ref|YP_002222675.1| from Borrelia recurrentis A1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|203287660|ref|YP_002222675.1|
Domain Number 1 Region: 191-328
Classification Level Classification E-value
Superfamily CBS-domain pair 1.05e-25
Family CBS-domain pair 0.0023
Further Details:      
 
Domain Number 2 Region: 330-411
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 0.000000000000003
Family CorC/HlyC domain-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|203287660|ref|YP_002222675.1|
Sequence length 413
Comment hemolysin [Borrelia recurrentis A1]
Sequence
MLELIIILILIILSAIFSASETAYTSLSLIQLQDIKKKGKLGTVVYNLSQNPSKLVTTIL
IGNNIANITASTLTTKFVLDKYGNNSLAFSTGIITIIVLICSEIFPKQIAILNNESIVLY
TSIFIKTLTIIFTPAIYIINGIVKILLNLCKITTNQKITKDSIKNMLSLAEKLGILENDD
RIFMQKMLNIGEVRASEIMTHRTEVFSLSSTSKLKDKIKLIKKEGYSRIPIYKGQNREQI
IGILITKDLIEISKKKLEKNIIKFIKPAVFVQQNKRIKDILDIMRQKQKIMAIVIDEYGG
FSGILTVEDIMEKIFGAIFDEYDFEEKKQLITKKDDNIYLISGETTFDEIEETVGIKIQH
KDYINTMGGYIMDLLDKIPTKGEQVNTEHGEYLIEEIQNHKIKKITFKKIQKE
Download sequence
Identical sequences B5RL27 B5RR20 I0FBX6 W5SGM5
gi|203287660|ref|YP_002222675.1| gi|386859428|ref|YP_006272134.1| WP_012537968.1.6979 WP_012537968.1.78452 WP_012537968.1.83678 WP_012537968.1.85550 WP_012537968.1.85720 412418.BRE_200 412419.BDU_201 gi|203284122|ref|YP_002221862.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]