SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|203287993|ref|YP_002223008.1| from Borrelia recurrentis A1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|203287993|ref|YP_002223008.1|
Domain Number 1 Region: 388-621
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000000209
Family Tropomyosin 0.017
Further Details:      
 
Domain Number 2 Region: 253-414
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000000262
Family Tropomyosin 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|203287993|ref|YP_002223008.1|
Sequence length 762
Comment hypothetical protein BRE_558 [Borrelia recurrentis A1]
Sequence
MMFMGKYKKIVSMIHKIFMLISCTLLFGEQKQYITKDYMFNYSTIYIPKEDLNEDFNNQN
NEEKTIYFKQNKVSKENDIHTFKKQLNKLSFKDSSQIQIANNRQIRNNIFTKDSDFEQNN
MDDDWFIQNIDNLKFRIKNYEKKITNIENLLNDTNIESIKRKNEEYAMLIKSLKEKIERI
KYLINTKENLLNDPYQDSYQAKNNDYNDYNEQRYEDNQKEYIPNESYNYPPTENTYDTYI
QEKEYSNSENTILNKLDSKINNNKDSLNNHTQILGNLDNKINNNKDSLNNHTQILGNLDS
KINNNKDSLNNHTQILGNLDSKINNNKDSLNNHTQILGNLDSKINNNKDSLNNHTQILGN
LDSKINNNKDSLNNHIQLLGDLDSKINNNKDSLNNHTQILGDLDSKINNNKDSLNNHTQI
LGDLDSKINNNKDSLNNHTQLLGDLDSKINNNKDSLNNPTQILGDLDSKINNNKDSLNNH
TQILGDLDNKINNNKDSLNNHTQILGDLDSKINNNKDSINNNIHKLGELDSKINNNGEIL
LAFHQELTKFKNDHDNSFKNIENNLLSIEKIINSLKNKIEKNEELYKENKNIIQQKQDQI
NILDKRLTNNENDILKLKEGLTKYVKKDSTKHKNRKSQQITQGSYPQDIQTTNKNAIIKN
AEFKIYPDTHLNNYNFKVQSNEFDFKKSNGYYIEIEPTKNLHRAKEIYKLIPKYNVKTHF
INPSLKHKEKFFRNLIKVEYTNDINTLYKNLASEFRNVRIIK
Download sequence
Identical sequences B5RPQ3
gi|203287993|ref|YP_002223008.1| 412418.BRE_558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]