SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|429220094|ref|YP_007181738.1| from Deinococcus peraridilitoris DSM 19664

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|429220094|ref|YP_007181738.1|
Domain Number 1 Region: 11-90
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 2e-16
Family 2Fe-2S ferredoxin-related 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|429220094|ref|YP_007181738.1|
Sequence length 118
Comment ferredoxin [Deinococcus peraridilitoris DSM 19664]
Sequence
MPKLNVQGYGEFEVGASERLVLALERVGVDILHRCGGQARCTSCRVEFMEGEPERMTQAE
RSVLEAKGLLGQARLSCQMLCDHDMSLRPVQTVASSGLESGKTPAGQIEPEPVWDSGA
Download sequence
Identical sequences L0A451
gi|429220094|ref|YP_007181738.1| WP_015236274.1.23726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]