SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218698563|ref|YP_002406192.1| from Escherichia coli IAI39

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218698563|ref|YP_002406192.1|
Domain Number 1 Region: 1-151
Classification Level Classification E-value
Superfamily 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK 3.14e-54
Family 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK 0.0000000759
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|218698563|ref|YP_002406192.1|
Sequence length 159
Comment 2-amino-4-hydroxy-6-hydroxymethyldihyropteridine pyrophosphokinase [Escherichia coli IAI39]
Sequence
MTVAYIAIGSNLASPLEQVNAALKALGDIPESRILAVSSFYRTPPLGPQDQPDYLNAAVA
LETTLAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMK
NRGFMLWPLFEIAPELVFPDGETLRQILHTRAFEKLSKW
Download sequence
Identical sequences A0A0A1A3Z2 A0A0E0V0I7 A0A0H3MCW9 A0A181WT31 B1LGU4 V0S841 V0X9C7
WP_000215148.1.101110 WP_000215148.1.10131 WP_000215148.1.101439 WP_000215148.1.101445 WP_000215148.1.101727 WP_000215148.1.11467 WP_000215148.1.12230 WP_000215148.1.12679 WP_000215148.1.13409 WP_000215148.1.14322 WP_000215148.1.14389 WP_000215148.1.14946 WP_000215148.1.14963 WP_000215148.1.15990 WP_000215148.1.16010 WP_000215148.1.16843 WP_000215148.1.18118 WP_000215148.1.18725 WP_000215148.1.18801 WP_000215148.1.19374 WP_000215148.1.22280 WP_000215148.1.23330 WP_000215148.1.23724 WP_000215148.1.23869 WP_000215148.1.23985 WP_000215148.1.24088 WP_000215148.1.24577 WP_000215148.1.24763 WP_000215148.1.2597 WP_000215148.1.26196 WP_000215148.1.27188 WP_000215148.1.28145 WP_000215148.1.28314 WP_000215148.1.29164 WP_000215148.1.29443 WP_000215148.1.29603 WP_000215148.1.30397 WP_000215148.1.31029 WP_000215148.1.31433 WP_000215148.1.32030 WP_000215148.1.33525 WP_000215148.1.36699 WP_000215148.1.3796 WP_000215148.1.38185 WP_000215148.1.40 WP_000215148.1.40842 WP_000215148.1.41481 WP_000215148.1.43216 WP_000215148.1.44422 WP_000215148.1.44784 WP_000215148.1.45806 WP_000215148.1.46991 WP_000215148.1.46994 WP_000215148.1.47533 WP_000215148.1.49258 WP_000215148.1.49788 WP_000215148.1.50947 WP_000215148.1.5158 WP_000215148.1.51690 WP_000215148.1.51881 WP_000215148.1.52137 WP_000215148.1.53556 WP_000215148.1.53693 WP_000215148.1.54993 WP_000215148.1.55472 WP_000215148.1.55563 WP_000215148.1.562 WP_000215148.1.56502 WP_000215148.1.57266 WP_000215148.1.57550 WP_000215148.1.59577 WP_000215148.1.59611 WP_000215148.1.59980 WP_000215148.1.60110 WP_000215148.1.60411 WP_000215148.1.62322 WP_000215148.1.65366 WP_000215148.1.65749 WP_000215148.1.66667 WP_000215148.1.67758 WP_000215148.1.68071 WP_000215148.1.69341 WP_000215148.1.72857 WP_000215148.1.74549 WP_000215148.1.74574 WP_000215148.1.77419 WP_000215148.1.77950 WP_000215148.1.80343 WP_000215148.1.81156 WP_000215148.1.81624 WP_000215148.1.8295 WP_000215148.1.84221 WP_000215148.1.86227 WP_000215148.1.86234 WP_000215148.1.87491 WP_000215148.1.88467 WP_000215148.1.9199 WP_000215148.1.92305 WP_000215148.1.92638 WP_000215148.1.93185 WP_000215148.1.93939 WP_000215148.1.94367 WP_000215148.1.94436 WP_000215148.1.94653 WP_000215148.1.95861 WP_000215148.1.96650 WP_000215148.1.96695 WP_000215148.1.9723 WP_000215148.1.97571 WP_000215148.1.99349 WP_000215148.1.99892 YP_002406192.1.10275 439855.EcSMS35_0153 585057.ECIAI39_0146 gi|170680561|ref|YP_001742270.1| gi|386622555|ref|YP_006142283.1| gi|218698563|ref|YP_002406192.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]