SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|320159736|ref|YP_004172960.1| from Anaerolinea thermophila UNI-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320159736|ref|YP_004172960.1|
Domain Number 1 Region: 368-558
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.54e-69
Family Pyruvate oxidase and decarboxylase PP module 0.00000849
Further Details:      
 
Domain Number 2 Region: 2-179
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.21e-62
Family Pyruvate oxidase and decarboxylase Pyr module 0.00000419
Further Details:      
 
Domain Number 3 Region: 189-351
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 4.18e-58
Family Pyruvate oxidase and decarboxylase, middle domain 0.0000566
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|320159736|ref|YP_004172960.1|
Sequence length 573
Comment acetolactate synthase, large subunit [Anaerolinea thermophila UNI-1]
Sequence
MMKRTGAQIVWETLMREGVEVVFGYPGGANLPIYDAMLDYPVRHVLVRHEQGAAHMADGY
ARASGKVGVAMATSGPGATNLVTGIATAMMDSSPVVFLTGQVVSKFIGYDAFQETDVTGI
TLPITKHNYLVTRVEELGDTLREAFYIARTGRPGPVLVDIAKDAQQNSTDWEYSDRPIQL
RGYRPNRHPLSKQVEQALEMLSTARKPLILAGRGVLLSGAMRELREFAERAHVPVAVTLL
GIGSFPASHPLSLGMMGMHGEAWVNQAIQESDLLLAFGMRFDDRVTGNLKTYAPNARKIH
LDIDPAEINKNVRVDVGIVGDLRESLQTFLEHLPQMDHSDWVEHINTLKGESAVRDIQYL
PPDGHLYAAHVIHDLWRYTGGNALVVTDVGQHQMWAAQYYRHDQPFQWITSGGLGTMGFG
LPAAIGARIARPDAEVWAIVGDGGFQMTAAELSTAAQEGVKVNVAIINNGFLGMVRQWQE
FFYDRRYAATPMRSPDFVKLAEAHGLTGLRVWRREEVFDAIQRARETDGTVVIDFRVEQE
DSVYPMVPAGADLHNMIRRPVRNPLVETAQDEM
Download sequence
Identical sequences E8N025
gi|320159736|ref|YP_004172960.1| WP_013558757.1.30606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]