SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|320159787|ref|YP_004173011.1| from Anaerolinea thermophila UNI-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320159787|ref|YP_004173011.1|
Domain Number 1 Region: 119-204
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 0.0000000000225
Family MJ1460-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|320159787|ref|YP_004173011.1|
Sequence length 210
Comment hypothetical protein ANT_03770 [Anaerolinea thermophila UNI-1]
Sequence
MEPIPKSGLYYSNKMARLALLALEEVMGKNGLNAILNLANLSHLIDNLPPDNLNREFDFA
DFSMLNGALEEMYGPRGGRGLAKRAGRAVFMEGLRNFGALAGAGDLAFKILPLSTKLRIG
IPAMAKIFSTTSDQYTTVEEKEDHFVYTIHKCPVCYGRHTDKPCCHIATGVILEGLRWVS
GGHEFKVEEVRCIACGDPTCDFIIYKEPES
Download sequence
Identical sequences E8N076
WP_013558808.1.30606 gi|320159787|ref|YP_004173011.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]