SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|320159861|ref|YP_004173085.1| from Anaerolinea thermophila UNI-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320159861|ref|YP_004173085.1|
Domain Number 1 Region: 22-246
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.5e-56
Family PFOR PP module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|320159861|ref|YP_004173085.1|
Sequence length 260
Comment 2-oxoglutarate ferredoxin oxidoreductase subunit beta [Anaerolinea thermophila UNI-1]
Sequence
MVMEQILPEEIVYQRPEALADVNTHYCPGCTHGVAHRLIAEVIDEMGIRDRMVGVASVGC
SVFAYNYFDFDWVQAPHGRAPAMATGIKRVLPDRFVVTYQGDGDMASIGMAEVVHAAARG
ENITVFFINNANYGMTGGQMAPTTLPGQRTTSSPSGRDVETAGYPIRAAELLATLEGASY
VVRRSLHDPKNIRLAKKAIRTALEVQAQGLGFSMVEFLSTCPTNWGMTPVDALHWLEEHM
IEYYPLGDFKVAPTVAQIRI
Download sequence
Identical sequences E8N0U0
WP_013558881.1.30606 gi|320159861|ref|YP_004173085.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]