SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|320160606|ref|YP_004173830.1| from Anaerolinea thermophila UNI-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320160606|ref|YP_004173830.1|
Domain Number 1 Region: 9-391
Classification Level Classification E-value
Superfamily Homocysteine S-methyltransferase 2.22e-105
Family Homocysteine S-methyltransferase 0.00000254
Further Details:      
 
Domain Number 2 Region: 899-1169
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 9.02e-78
Family Methionine synthase SAM-binding domain 0.0019
Further Details:      
 
Domain Number 3 Region: 349-618
Classification Level Classification E-value
Superfamily Dihydropteroate synthetase-like 5.36e-77
Family Methyltetrahydrofolate-utiluzing methyltransferases 0.00064
Further Details:      
 
Domain Number 4 Region: 717-866
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-binding domain 2.22e-34
Family Cobalamin (vitamin B12)-binding domain 0.0000922
Further Details:      
 
Domain Number 5 Region: 642-731
Classification Level Classification E-value
Superfamily Methionine synthase domain 1.44e-18
Family Methionine synthase domain 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|320160606|ref|YP_004173830.1|
Sequence length 1172
Comment methionine synthase [Anaerolinea thermophila UNI-1]
Sequence
MKRIYTNRRYLDLIQKRVAIFDGAMGTSLQKQNLTAEHFGGERYVGCNDYLVLTYPQAVE
TVHRSFLEAGVDVLETDTFRSNRITLAEYGLQNRVLDINRAAANLARRLADEYTRKTGQM
RLVAGSIGPSGKLPSMNDPELSNITFDELADVFREQARGLMEGGVDLLLIETSQDILEVK
AAITGIQQAFTETGIVIPLQAQVTLDTTGRMLLGTDIAAVLAILEGMPIDAIGLNCSTGP
DYMREPIRYLAEHAPVPVSCIPNAGLPLNVDGQAVYPLEPEPFATALSEYVDRFGVGIVG
GCCGTTPEHLRKLVEKIDAHPASHRPIFSLPKLASATQAVLMVQEPAPFLIGERLNTQGS
ARFKKMILAEDFEGALEIARQQVEAGAHGLDLCTALTERSDEGELMRRLIKTLAPTVRVP
FVIDTTEPDVMEIALKTAPGRCLLNSVNLEAGAAKATRILQLAKMYNAAVIALTIDEQGM
AKTAQRKLEIARRIYHLAVDEMGLRPQDLVFDALTFTLATGDPEFSRSAMETMDGIRLIK
AELPGVLTSLGVSNVSFGLKPAARGVLNSVMLYHCVQAGLDMAIVNPAQITPYPDIPAEE
RELAEDLIFNRRPDALQRLIEYFESHGKEEQKTTAQHSALEGKTAEERLHWRIVHRQKEG
VEADIDEILQRPSQQSRHETAVRVLNEVLLPAMKEVGDRFGAGELILPFVLQSAEVMKKA
VSHLEQYLEKKEGVSKGTLVLATVYGDVHDIGKNLVKTILSNNGYTVIDLGKQVPAETII
TKAVEVKADAIGLSALLVSTSKQMPLIVNELHRRGLKFPVLIGGAAINRNFGRRILQTED
GSFYDPGVFYCKDAFEGLSTMDALMDAGTRLTLVQQIIREAEIELGRRPARERSLSSGIE
RSETPAAPRIPQAPFWGAKVVHSMPLELVFQHLSINELFRLSWGAKNTHGEAWKQLEAEF
TQRLEQMKREALKEGWLKPQGVYGYFPAQSDGNDLVIYNPQSLDTGKPVELVRFTFPRQP
EGEKLCLADYFAPVESGQMDVVAFQVVTVGESATEKFERLQEEGNYTEAYYVHGLAVQTA
EATAAYLHNHIRRELGLDAEQGKRYSWGYPAIPDLADHQKVFQLLPAESALKMSLSPAYQ
LIPEQSTAAIIVHHPQAKYFNVGESRIEQLMR
Download sequence
Identical sequences E8N466
gi|320160606|ref|YP_004173830.1| WP_013559618.1.30606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]