SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|320160830|ref|YP_004174054.1| from Anaerolinea thermophila UNI-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320160830|ref|YP_004174054.1|
Domain Number 1 Region: 3-318
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.79e-103
Family Branched-chain alpha-keto acid dehydrogenase PP module 0.000000207
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|320160830|ref|YP_004174054.1|
Sequence length 319
Comment putative pyruvate dehydrogenase E1 component alpha subunit [Anaerolinea thermophila UNI-1]
Sequence
MEKDEYFRMYREMVVIRRLEERSAELYQQGKIGGFLHLYIGQEAVSTGLISARKPQDRVI
TAYRDHGVAINCGLSAREVMAELLGKATGCSKGKGGSMHLADVTKNFWGGHAIVGAHLPI
ATGLALGDAYKGEKNVTICMFGDGATNIGFFHEALNMSKIWNLPVLWVCENNQYGMGTAV
ERASAVSEIIQKAQAYAMPSRRVDGMDVMAMRQAAEEMIEAIRNGAGPMLMEAMTYRFRG
HSMGDPERYRKPEEVHRYQENDPIGIFRKYLQENGIATEEELNQLDDEAEAIVEDAVQFA
EASPEPQPHELFEHIYVEA
Download sequence
Identical sequences E8N4U0
gi|320160830|ref|YP_004174054.1| WP_013559836.1.30606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]