SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|320160831|ref|YP_004174055.1| from Anaerolinea thermophila UNI-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320160831|ref|YP_004174055.1|
Domain Number 1 Region: 2-203
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.18e-68
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.0000033
Further Details:      
 
Domain Number 2 Region: 187-324
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 8.51e-42
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.0000485
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|320160831|ref|YP_004174055.1|
Sequence length 325
Comment putative pyruvate dehydrogenase E1 component beta subunit [Anaerolinea thermophila UNI-1]
Sequence
MARITMREAISQALWEEMERDPNVFILGEEVGVWGGTYAVTKGFYDHFGPERVRDTPIAE
AGIIGAAIGAALTGLRPVAELMTINFAFSAMDHIVNQAAKLHYMFGGQMVLPMVIRAVGG
GGRQLGATHSQTPDAVFAHFPGLKVVAPGTPADAKGLLKAAIRSNDPILFIEHATLYQMR
GEVPEGDYTVPIGKSTIQRPGRDVTIVTYSKMLEISLKAADQLAKEGIEVEIVDLRTLRP
LDMEPVLESFKKTNRAVIVEEGWKSYGVGAEIASRIYEEAFDYVDAPIRRVAQKEVPLPY
NRTLEQMALPKVEDVIQAVKEVLNG
Download sequence
Identical sequences E8N4U1
WP_013559837.1.30606 gi|320160831|ref|YP_004174055.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]