SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|320160963|ref|YP_004174187.1| from Anaerolinea thermophila UNI-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320160963|ref|YP_004174187.1|
Domain Number 1 Region: 3-224
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 9.61e-61
Family PFOR Pyr module 0.056
Further Details:      
 
Domain Number 2 Region: 348-560
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.89e-37
Family PFOR PP module 0.03
Further Details:      
 
Domain Number 3 Region: 538-600
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.00000000000454
Family Short-chain ferredoxins 0.053
Further Details:      
 
Domain Number 4 Region: 226-283
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0000215
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|320160963|ref|YP_004174187.1|
Sequence length 609
Comment indolepyruvate oxidoreductase subunit IorA [Anaerolinea thermophila UNI-1]
Sequence
MKRLLSGNEAVARGAWTAGAVVGSGYPGTPSTEIMEIFARYPGVYAEWAPNEKVALDVAI
GAAYAGRRAFATMKHVGLNVAADSLFYAAMTGIEAGLVIVSADDPSMHSSQNEQDNRQYA
KFVRIPCIDPADSQEAHDFAIAAFDLSERFDTPVLLRLTTRVCHTSTPVEVSEQRFVSSD
PIKYPRNVAKYVMVPANARRRHGVIEHRIQEISQYAETSPLNRMEIRSSQLGIITGGIAY
QYAREVFPEASILKLGLVYPLPAALIRNFASMVERLIVLEELDPFIEHQVRLLGVELYRG
KQTLDTPKGIFPIVGELNAQIVRKAAIEAGLIEGEMLQTSPSFPMELPQRPPVLCPGCPH
RGAFFVLSKLKVPVNGDIGCYTLGLTEPLNAIHTCGCMGASIGVAHGAAVAGDQERHVAV
IGDSTFFHTGIPALINVVYNRSNVITIIMDNRVTGMTGHQDNPGTGKTLQGRDTTEIDIE
NVVRALGFTYVKTLNGYDVEGIEKTLKEWMKISDPAVLITREECALLPEARAKYVPLEVV
EEKCNGCTMCFRVGCPAISKSEKLDPRYQRPLAVIDPSLCTGCEICAQVCPRDAILFRNQ
VLDKQEIDQ
Download sequence
Identical sequences E8N573
gi|320160963|ref|YP_004174187.1| WP_013559969.1.30606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]