SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|320161210|ref|YP_004174434.1| from Anaerolinea thermophila UNI-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320161210|ref|YP_004174434.1|
Domain Number 1 Region: 5-325
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 8.3e-114
Family TK-like PP module 0.0000000488
Further Details:      
 
Domain Number 2 Region: 337-527
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.39e-68
Family TK-like Pyr module 0.00000134
Further Details:      
 
Domain Number 3 Region: 536-667
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.86e-37
Family Transketolase C-terminal domain-like 0.0000568
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|320161210|ref|YP_004174434.1|
Sequence length 670
Comment transketolase [Anaerolinea thermophila UNI-1]
Sequence
METKEFQNKALNTIRFLSADGVQKANSGHPGLPMGAAAIAYTVWTRHLRHNPANPGWFNR
DRFILSGGHGSMLLYSLLHLTGYDLPLEELQQFRQWGSRTPGHPEYGLTPGVETTTGPLG
QGFANGVGMAIAEKHLAAVYNRPGHEIIDYFIYALVTDGDLMEGVAAEAASLAGHLKLGN
LIYLYDDNRITIEGSTDVAFTEDRAKRFEAYGWQVLFVEDGNDVDAIDSAISLAKTDPRP
SLIVVRTHIGYGLPTRQDTAKAHGEPPGEEELRGAKVKLGWPLEPSFYIPDDVLAFFRQA
VERGKHWEEEWQRKFEAYRQSYPDLASELERRILGKLPDNWAEGLPEFPADPKGMATRVA
SGKVLNALAARLPELMGGSADLAPSTMTWMNSSPSFQAESPEGRNLQFGVREHGMGAIVN
GMAYNGAFIPFGSTFLVFADYMRGAIRLSALSHLGSIWVFTHDSIGLGEDGPTHQPVEHL
ASLRAIPNLVVLRPADANETREAWKVAIERRHAPTVLALSRQPVPTLDRTELAPASGVAQ
GAYVLADLGDKLPEVILMASGSEVALIYEAGKELAREGIAVRLVSFPSWELFAQQDVSYR
ESVLPSHIKHRIAVEAGIGMGWERWVGCEGKIISIERFGASAPYKVIYQQLGLTVERIVE
EAQSLLRGGY
Download sequence
Identical sequences E8N5X0
WP_013560212.1.30606 gi|320161210|ref|YP_004174434.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]