SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|320161216|ref|YP_004174440.1| from Anaerolinea thermophila UNI-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320161216|ref|YP_004174440.1|
Domain Number 1 Region: 9-238
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.72e-61
Family Pyruvate oxidase and decarboxylase PP module 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|320161216|ref|YP_004174440.1|
Sequence length 346
Comment 2-oxoglutarate ferredoxin oxidoreductase subunit beta [Anaerolinea thermophila UNI-1]
Sequence
MADIQALNAIGLSRTDYRGLPSTLCQGCGHNAVSNQIIQAMYEMNIQPEKIVKFSGIGCS
SKSPAYFLGRSFAFNGVHGRMPSLATGALFADTSLYGMGVSGDGDTASIGMGQFKHVIRR
NLPMVYIVENNGVYGLTKGQFSATAEKGLTLKHEGTNLFLPVDICLEALASNATFVARGF
AGDPKQLKELLKAAIKHRGTAVLDIISPCVTFNNKDDTIHSYAFGKEREVRLHDLIFVPA
RDQLTIEDFEEGTVRDVELYDGSVITLRKLERDYDPTSRSEAFRILEEARERRELITGLI
YVEPDAPSIFDLYELPEKPLNRMTEGELRPASQTLNQVHSWLFSNL
Download sequence
Identical sequences E8N5X6
WP_013560217.1.30606 gi|320161216|ref|YP_004174440.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]