SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|320161217|ref|YP_004174441.1| from Anaerolinea thermophila UNI-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320161217|ref|YP_004174441.1|
Domain Number 1 Region: 218-495
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.67e-65
Family PFOR Pyr module 0.01
Further Details:      
 
Domain Number 2 Region: 23-240
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.18e-21
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.013
Further Details:      
 
Domain Number 3 Region: 506-594
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0000000000000123
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|320161217|ref|YP_004174441.1|
Sequence length 615
Comment 2-oxoglutarate ferredoxin oxidoreductase subunit alpha [Anaerolinea thermophila UNI-1]
Sequence
MPLTEQLETVSSPQVNPEVINDFAITFCTVNGSGSATANLTVMRALFKMGIPVSGKNIFP
SNIQGLPTWYTIRVSKDGYVGRVEKDNIIVAMNPATFVKDLEFLVPGGVVLYNEDIKTPP
NRDDLIYYPMPVKQLIKTVEIPSQLRDFVSNMVYVGILSYLLDIDLNAVHAALEFHFKGK
KTPIESNMAVIQNAYQWAKENLQKKDPYKVAPMDKTKGKLLADGNTAAALGSIYGGVQFV
SWYPITPASSLPEALIEYLPKLRTDPETGKQNYVVVQAEDEIAAIGMLVGAGWAGLRAMT
ATAGPGLSLMSEYMGLAYFAEVPLVVWDVQRVGPSTGLPTRTAQGDITEVYFMSHGDTQY
IQLFPGNINECFEFGWRAFDIAERLQMPVVVMSDLDLGMNNWMCDPFEYPQTPMDRGKVL
WEKDLEAILQKNEGKWGRYLDVDGDGIPYRTLPGNLHPKSAYFARGTGHDEFAGYSEDPE
VWERVLNRLAKKWETAKQYIPENVLYPRDGAEIGIIAVGSTEPAILEALDLLEQEGIKAD
YLRIRAFPLKEDVQKFIESHQRIYVVEINRDGQLRQILMINYPQNAGKLIQVSRINGLPL
SARWIRDEILAQERK
Download sequence
Identical sequences E8N5X7
WP_013560218.1.30606 gi|320161217|ref|YP_004174441.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]