SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|320161262|ref|YP_004174486.1| from Anaerolinea thermophila UNI-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320161262|ref|YP_004174486.1|
Domain Number 1 Region: 6-332
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 2.56e-68
Family DmpA-like 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|320161262|ref|YP_004174486.1|
Sequence length 336
Comment hypothetical protein ANT_18600 [Anaerolinea thermophila UNI-1]
Sequence
MDTYPGSITDVPGILVGHAQNAEALTGCSVVICEQGATGGVDQRGGAPGTRETDALRPMH
LVEKIHAVVLSGGSAFGLSAASGAMRWLAEKGIGFPTGVVPVPIVASAILFDLGIGDPTI
YPDEAMGYHACQQAVSAPPTQGNAGAGTGATAGKILGMSQAMKSGIGTASMYLSGGIVIG
ALVAVNPLGDVIDPESGKILCGARTLKKGPVQIGKSSVFADTLAVMNSLAGRSILHFAAR
QNTVIGVVATNAKLSKEQANYVAMMAQDGLAMSIRPAHTLLDGDTLFVMATGEKRADPNI
IGAYSAQVVARAIVNAVLYAQPVGGIPCAGDYLSKS
Download sequence
Identical sequences E8N622
WP_013560263.1.30606 gi|320161262|ref|YP_004174486.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]