SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|320162233|ref|YP_004175458.1| from Anaerolinea thermophila UNI-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320162233|ref|YP_004175458.1|
Domain Number 1 Region: 804-1184
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.39e-129
Family PFOR PP module 0.0000000218
Further Details:      
 
Domain Number 2 Region: 425-676
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.75e-83
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.000000234
Further Details:      
 
Domain Number 3 Region: 4-259
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 9.22e-81
Family PFOR Pyr module 0.0000000259
Further Details:      
 
Domain Number 4 Region: 260-420
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.24e-46
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0000131
Further Details:      
 
Domain Number 5 Region: 673-845
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 8.37e-24
Family Ferredoxin domains from multidomain proteins 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|320162233|ref|YP_004175458.1|
Sequence length 1190
Comment putative pyruvate:ferredoxin oxidoreductase [Anaerolinea thermophila UNI-1]
Sequence
MSNRQKITLDGNEAVARVAYRASEVIAIYPITPSSAMGEWSDEWMAKKVKNLWGTVPLVV
EMQSEGGAAGAVHGALQSGALSTTFTASQGLLLMIPNMYKIAGELTPLVIHVSARALAAQ
ALSIFGDHSDVMATRQTGFALLASRSVQEAHDMALIAHAATLEARVPFLHFFDGFRTSHE
VQKIEELTEDDMRAMISDELIAEHRKRALSPDHPVLRGTAQNPDVYFQGRETVNPFYART
PEIVQKTMDRFAQLTGRAYHLFEYAGAPDAERVIVLMGSGAETAEETAKYLVERGEKVGV
VTVHLYRPFSAKHLLAALPATTKAIAVLDRTKEPGSAGEPLYQDVVTAVTEGLAGGFAPF
KTLPTMIGGRYGLSSKEFTPGMVKAVFDELKKSQPKNHFTVGIVDDVSFTSLDYDPDFEI
LDSSTVQCVFFGLGSDGTVGANKNSIKIIGEETENNAQGYFVYDSKKSGSVTISHLRFGP
KPLRAPYLIRQADFVACHQFSFLERLDITRYAKPGAVFLLNSIYGPDEVWNHLPREVQKD
IIEKKLKFYVIDAYEVANRTGMGQRINTIMQTCFFAISGVLPREQAIAEIKKAIQKTYGK
RGEAVVQKNFEAVDQTLANLYEVKVPDQVTSTFSRRPAVGPEAPEFVRDVLAPMMVFEGD
NLPVSAMPVDGTFPTATAQYEKRNIALEIPVWEPDLCIQCGKCAMVCPHAVIRMKVYEPE
LLANAPATFKSIDAKFKEFPNTKFTIQVAPEDCTGCALCVEACPAKDKTQAGRKAINMAP
QPPIREQERENWNFFLSLPDVDPTAVAPTTVKNSQLLRPLFEFSGACAGCGETPYVKLLS
QLFGERAVIANATGCSSIYGGNLPTTPWAKNAEGLGPAWSNSLFEDNAEFGLGFRLTIDK
LNEYARELLTDLSGLVGSDLSAAILEADQSTEAGVREQRKRVAALKEILKGIKDPRAFNL
LNVADYLVRKSVWIVGGDGWAYDIGYGGLDHVLASGRNVNILVLDTEVYSNTGGQASKST
PRAAVAKFAMSGKGLPKKDLGMIAMSYGYVYVARVAMGANDQQTLRAFLEADAYEGPSLI
IAYSHCIAHGIDMRKGLDQQKLAVNSGVWPMYRYNPMLALEGKNPLIIDSKDPSVDVQEY
AYNETRYRMLVQADEARAEMLMQQAREDARKRWELYKQMAAIQYKSNGND
Download sequence
Identical sequences E8N1B5
gi|320162233|ref|YP_004175458.1| WP_013561204.1.30606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]