SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|320162251|ref|YP_004175476.1| from Anaerolinea thermophila UNI-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320162251|ref|YP_004175476.1|
Domain Number 1 Region: 10-124
Classification Level Classification E-value
Superfamily AF1862-like 3.14e-33
Family Cas Cmr5-like 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|320162251|ref|YP_004175476.1|
Sequence length 125
Comment hypothetical protein ANT_28500 [Anaerolinea thermophila UNI-1]
Sequence
MAETISKQRLLEQERASHAYDAVVKAKGKKDKELKSLARSAPASIQSNGLGQTLAFWKAK
NEEHHLALYHALSGWLKKQLHIDENRDLLEWIATTADSLQYRQATAEALAYLNWYKRFAE
AELKE
Download sequence
Identical sequences E8N1D3
gi|320162251|ref|YP_004175476.1| WP_013561221.1.30606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]