SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|320162301|ref|YP_004175526.1| from Anaerolinea thermophila UNI-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320162301|ref|YP_004175526.1|
Domain Number 1 Region: 139-202
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000000889
Family NfeD domain-like 0.0076
Further Details:      
 
Weak hits

Sequence:  gi|320162301|ref|YP_004175526.1|
Domain Number - Region: 86-138
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.0732
Family Multidrug resistance efflux transporter EmrE 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|320162301|ref|YP_004175526.1|
Sequence length 205
Comment hypothetical protein ANT_29000 [Anaerolinea thermophila UNI-1]
Sequence
MTFDFLLDPNIGFVLLIGGVVLAILALFMPGTGLLEIGALFALVLAGYTLANLPLNVWAV
VLFFVGIIPFILALIWRGSRRGLIALLISLVMLVIGSIFAFRSPRGGSAVNPVLAVLVTG
GSAGLLWFMARKSIDAAIQRPSHDYDRLVGMIGEARTDIRGQGAVYVGGEEWTATCAEYV
PAGTPVRVLRRKGLFLEVEPVKKEE
Download sequence
Identical sequences E8N1X9
WP_013561271.1.30606 gi|320162301|ref|YP_004175526.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]