SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|311068037|ref|YP_003972960.1| from Bacillus atrophaeus 1942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|311068037|ref|YP_003972960.1|
Domain Number 1 Region: 171-569
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 1.33e-102
Family beta-Lactamase/D-ala carboxypeptidase 0.0000307
Further Details:      
 
Domain Number 2 Region: 52-220
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 7.72e-44
Family Penicillin binding protein dimerisation domain 0.00088
Further Details:      
 
Domain Number 3 Region: 584-637
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000000000746
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|311068037|ref|YP_003972960.1|
Sequence length 639
Comment penicillin-binding protein [Bacillus atrophaeus 1942]
Sequence
MRVSNVTVRKRLLFVLLFGVIVFLIIDTRLGYVQFVLGDKLTSLAKDSWSRNLPFEPERG
EILDRNGVKLATNKSAPTVFVVPRQVQNPVSTSKQLAAVLNMSEEKVYKHLTKKASIEKI
TPEGRKISNKKAKEIKALDLKGVYVAEDSIRHYPFGSFLSHVLGFAGIDNQGLLGLEAYY
DDDLKGEKGSVKFYTDAKGKKMPDEADDYTPPKDGLDMKLTVDSKVQTIMERELDNAEAK
YNPDGMIAVAMNPKNGEILAMSSRPDFDPADYQSVDSSVYNRNLPVWSTYEPGSTFKIIT
LAAALEEQKVNLKRDQYYDKGHTEVDGARLRCWKKGGHGLQTFLEVVQNSCNPGFVELGE
RLGKEKLFKYIKSFGFGQKTGIDLQGEGTGILFPLDKVGPVEQATTAFGQGVSVTPIQQV
AAVSAAVNGGTLYTPYIAKEWIDPVTKKTVKKQSPVAKKQVISEETSKQIRYALESVVAE
GTGRNAFVEGYRVGGKTGTAQKVKDGKYLENNHIVSFIGFAPADDPSLVVYVAVDNPKGT
IQFGGTVAAPIVGNIMRDSLPEIGVKPRKNQIEKKYQWSDTKSIEVPNVVGMSVSDLESL
LVNLQIDSSGKGSKIVKQSPAAGTKVKEGSKIRVYLSEE
Download sequence
Identical sequences A0A080UK96 A0A0H3E2M9
gi|311068037|ref|YP_003972960.1| WP_013390506.1.100936 WP_013390506.1.10353 WP_013390506.1.15971 WP_013390506.1.16994 WP_013390506.1.30485 WP_013390506.1.32777 WP_013390506.1.39473 WP_013390506.1.39900 WP_013390506.1.40255 WP_013390506.1.52389 WP_013390506.1.53439 WP_013390506.1.59507 WP_013390506.1.62747 WP_013390506.1.68581 WP_013390506.1.69262 WP_013390506.1.70004 WP_013390506.1.72801 WP_013390506.1.7305 WP_013390506.1.7508 WP_013390506.1.79721 WP_013390506.1.94463 WP_013390506.1.99425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]