SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|311068098|ref|YP_003973021.1| from Bacillus atrophaeus 1942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|311068098|ref|YP_003973021.1|
Domain Number 1 Region: 8-269
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.01e-85
Family Protein kinases, catalytic subunit 0.00000101
Further Details:      
 
Weak hits

Sequence:  gi|311068098|ref|YP_003973021.1|
Domain Number - Region: 358-419
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000876
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0083
Further Details:      
 
Domain Number - Region: 496-555
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0107
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0087
Further Details:      
 
Domain Number - Region: 426-480
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0177
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|311068098|ref|YP_003973021.1|
Sequence length 646
Comment protein kinase [Bacillus atrophaeus 1942]
Sequence
MLIGKRISGRYQILRVIGGGGMANVYLAEDIILEREVAIKVLRFDFANDNEFIRRFRREA
QSASSLDHPNIVSIYDVGEEEDIYYIVMEYVEGMTLKEYITANGPLHPKEALRIMEQIVS
AIAHAHHNHIVHRDIKPHNILIDHMGNIKVTDFGIATALSSTTITHTNSVLGSVHYLSPE
QARGGLATKKSDIYALGIVLFELVTGRIPFEGESAVSIALKHLQTETPSAKRWNSAVPQS
VENVILKATAKDPFHRYESAEDMGEDIKTAFDARRLNEKKFSVLEDEEMTKAIPIIKDAD
QASPSDKENADEASHGKKTKKGKKKKWPWVLLAVCFILITAGVLAVTVFPSLFMPKDVKI
PDVQGMEYEEAADLLEKNGLQVDSDVLEISDEKIEEGLMVKTDPKADSTVKEGSSVKLYK
STGKAKTQLNDVTGQTVERAKEALKKKGFENITVKEVHDDEESGTVIDQEPSAGTDLVPS
DDQVKLTVSIGPEDITLRDLTTYSKQAASGYLEDNGLTLVEKEAHSDDIPEGQVVKQNPK
AGTALKPGNEVEVTFSLGPEKKPVKTVKEKIQIPYEPENEGDELEVQISIDDADHSISDS
YENFKIKEPTERTIELKIEPGQKGYYQVTVDNKVVSYKTIEYPKDE
Download sequence
Identical sequences A0A080UMC2 A0A0H3DYK1
gi|311068098|ref|YP_003973021.1| WP_013390511.1.100936 WP_013390511.1.10353 WP_013390511.1.15971 WP_013390511.1.16994 WP_013390511.1.32777 WP_013390511.1.39473 WP_013390511.1.39900 WP_013390511.1.40255 WP_013390511.1.59507 WP_013390511.1.62747 WP_013390511.1.68581 WP_013390511.1.69262 WP_013390511.1.70004 WP_013390511.1.72801 WP_013390511.1.7305 WP_013390511.1.7508 WP_013390511.1.79721 WP_013390511.1.99425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]