SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|311069864|ref|YP_003974787.1| from Bacillus atrophaeus 1942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|311069864|ref|YP_003974787.1|
Domain Number 1 Region: 146-345
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 6.02e-58
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000055
Further Details:      
 
Domain Number 2 Region: 430-562
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 8.24e-35
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000516
Further Details:      
 
Domain Number 3 Region: 13-145
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 2.29e-32
Family Duplicated SiR/NiR-like domains 1 and 3 0.0028
Further Details:      
 
Domain Number 4 Region: 347-423
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 2.94e-23
Family Duplicated SiR/NiR-like domains 1 and 3 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|311069864|ref|YP_003974787.1|
Sequence length 573
Comment sulfite reductase subunit beta [Bacillus atrophaeus 1942]
Sequence
MVNNILKAPEGSPSDVEDIKEKSDYLRGTLKEVMLDRISAGIPDDDNRLMKHHGSYLQDD
RDLRNERQKQKLEPAYQFMLRVRMPGGVSTPAQWLVMDDLSQKYGNNTLKLTTRETFQMH
GILKWNMKKTIQEINAALLDTIAACGDVNRNVMCASNPYQSEIHTEVYEWSKKLSDDLLP
RTRAYHEIWLDEERVAGTPETEEVEPMYGPLYLPRKFKIGIAVPPSNDVDVFSQDLGFIA
IVEEGKLIGFNVAIGGGMGMTHGDQATYPQLAKVIGFCKPEQMYDVAEKVITIQRDYGNR
SVRKNARFKYTVDRLGVETVKAELENRLGWSLAEAKAFHFDHNGDRYGWVKGVEGKWHFT
LFVEGGRITDYDDYKLMTGLREIAKVHTGEFRLTSNQNLIISNVTSQNKDAISSLIEKYG
LTDGRQHSALRRSSMACVALPTCGLAMAEAERYLPVLIDKIEDIVNENGLRDEEITIRMT
GCPNGCARHALGEIGFIGKAPGKYNMYLGAAFDGSRLSKMYRENIGEEEILSELNVLLSR
YAKERNEGEHFGDFVIRAGVIKATTDGTNFHHE
Download sequence
Identical sequences A0A080UHC5 A0A0H3E3M6
WP_003326931.1.100936 WP_003326931.1.10353 WP_003326931.1.15971 WP_003326931.1.16994 WP_003326931.1.32777 WP_003326931.1.39473 WP_003326931.1.39900 WP_003326931.1.40255 WP_003326931.1.45236 WP_003326931.1.52389 WP_003326931.1.53439 WP_003326931.1.59507 WP_003326931.1.62747 WP_003326931.1.68581 WP_003326931.1.69262 WP_003326931.1.70004 WP_003326931.1.72589 WP_003326931.1.72801 WP_003326931.1.7305 WP_003326931.1.7508 WP_003326931.1.79721 WP_003326931.1.99425 gi|311069864|ref|YP_003974787.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]