SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|311070048|ref|YP_003974971.1| from Bacillus atrophaeus 1942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|311070048|ref|YP_003974971.1|
Domain Number 1 Region: 2-130
Classification Level Classification E-value
Superfamily FlgN-like 2.35e-16
Family FlgN-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|311070048|ref|YP_003974971.1|
Sequence length 160
Comment flagellar protein [Bacillus atrophaeus 1942]
Sequence
MSAKPIIEQLKRLCVLHEHLLTLSEEKTEALKAGKTKELSNILTKEQKYIQAIGQVEEER
MKATSEFLGFGKNNTVTTCIKKASGKEKNELEQLFQSLSEQLNGLKEINELNKQLTKQAL
QFISLTFDMLVPQENNINYGQSVQANHPAGSRLKLFDSQA
Download sequence
Identical sequences A0A080UQA1 A0A0H3E840
WP_003326723.1.100936 WP_003326723.1.10353 WP_003326723.1.15971 WP_003326723.1.16994 WP_003326723.1.32777 WP_003326723.1.39473 WP_003326723.1.39900 WP_003326723.1.40255 WP_003326723.1.59507 WP_003326723.1.62747 WP_003326723.1.68581 WP_003326723.1.69262 WP_003326723.1.70004 WP_003326723.1.72589 WP_003326723.1.72801 WP_003326723.1.7305 WP_003326723.1.7508 WP_003326723.1.79721 WP_003326723.1.99425 gi|311070048|ref|YP_003974971.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]