SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|311070714|ref|YP_003975637.1| from Bacillus atrophaeus 1942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|311070714|ref|YP_003975637.1|
Domain Number 1 Region: 8-235
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 9.26e-53
Family PP-loop ATPase 0.00034
Further Details:      
 
Domain Number 2 Region: 370-443
Classification Level Classification E-value
Superfamily PheT/TilS domain 1.05e-17
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.014
Further Details:      
 
Domain Number 3 Region: 215-322
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 0.0000000000183
Family MesJ substrate recognition domain-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|311070714|ref|YP_003975637.1|
Sequence length 472
Comment tRNAile lysidine synthetase [Bacillus atrophaeus 1942]
Sequence
MNSVKDFFEKYNLHLEGATIIVGVSGGPDSMALLNFLHTRFGRASVIIAAHVDHSFRGAA
SEEDMRFVQAYCKTERITCETVKMDVSAYAEMNRLNKQAAARECRYRFFKDLMVKHQADY
LALAHHGDDQVETMLMRLAKGTLGAGLAGIQPVRKFETGWLIRPFLSITKEDVLTYCLEH
DVRYRTDESNAKDDYTRNRFRKAVLPFLKQESHDVHRKFQKVSESLTEDEQYLQSLTKDE
MNKVITSQSETSVELNSAALLALPMPLQRRGVQLILNYLYENVPSSFSARHIQQFLEWAK
NGSPSGVLDFPNGLKVVKSYQTCLFTFEQLQCKEVPFEYQISGAAGETVILPGGSQITVE
RDAESLDGIGNAVFITSQDKVRFPLTVRTRRIGDRMKLKGMNGSKKVKDIFIDKKLPLQM
RDSWPIVTDATGEIIWIPGLKKSIFEDLVIPNGDRIVLQYRQHEMCRGQAKS
Download sequence
Identical sequences A0A087JX90 A0A0H3E648
WP_003328559.1.100936 WP_003328559.1.10353 WP_003328559.1.15971 WP_003328559.1.16994 WP_003328559.1.32777 WP_003328559.1.39473 WP_003328559.1.39900 WP_003328559.1.40255 WP_003328559.1.59507 WP_003328559.1.62747 WP_003328559.1.68581 WP_003328559.1.69262 WP_003328559.1.70004 WP_003328559.1.72589 WP_003328559.1.72801 WP_003328559.1.7305 WP_003328559.1.7508 WP_003328559.1.79721 WP_003328559.1.99425 gi|311070714|ref|YP_003975637.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]