SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|311070985|ref|YP_003975908.1| from Bacillus atrophaeus 1942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|311070985|ref|YP_003975908.1|
Domain Number 1 Region: 627-794
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 4.84e-49
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0009
Further Details:      
 
Domain Number 2 Region: 4-192
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.42e-42
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0016
Further Details:      
 
Domain Number 3 Region: 143-306
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.59e-29
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0031
Further Details:      
 
Domain Number 4 Region: 513-635
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 3.34e-23
Family Duplicated SiR/NiR-like domains 1 and 3 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|311070985|ref|YP_003975908.1|
Sequence length 805
Comment assimilatory nitrite reductase subunit [Bacillus atrophaeus 1942]
Sequence
MGKKQLVLVGNGMAGVRAIEEILNVSKDEFQITIFGSEPHPNYNRILLSKVLQGDTDIKD
ITLNDWNWYEENNIQLYTNETVIKVDPENKTVITDSDRIQPYDELILATGSVPFILPIPG
ADKKGVTAFRDIKDTDIMLAASKEYKKAAVIGGGLLGLEAARGLLNLGMDVSVIHLAPFL
MERQLDATAGRLLQNELEKQGMTFLLEKQTEEIYGDDRVEGVRFKDGTSIEADLVVMAVG
IRPNTKLGAESGIPVNRGIIVNDYMQTEIPHIYAVGECAEHRGIAYGLVAPLYEQAKVLA
KQICGIDTNPYEGSILSTQLKVSGVEVFSAGDFNESDDKKAIKVFDEQDGIYKKIVLREN
QIVGAVLFGDSSEGNRLFSMIQKEADISETSKISILQPLNQEAGTSLVAAMSDDEIICGC
NGVSKGNIIHAIQEQGCSSTDEIKACTGASRSCGGCKPLVEELLQYTLGSDFAASAQKEA
ICGCTSLSRDEVVEEIKAKGLSHTKEVMNVLGWKTPEGCSKCRPALNYYLGMVNPTKYED
ERTSRFVNERMHANIQKNGTYSVVPRMYGGVTNSNDLRKIADVVDKYEIPLVKMTGGQRI
DLIGVKKEDLPKVWSDLDMPSGYAYGKTLRTVKTCVGEQFCRFGTQDSMALGIALEKKFE
GLNTPHKVKMAVSACPRNCAESGIKDLGVVGIDGGWELYVGGNGGTHLRAGDLLMKVKTD
EEVLEIAGAYLQYYRETAHYLERTSAWLERVGLSHVQSVLNDPETRQELNDRMNETLSVH
KDPWKDFLEDKQTSKELFENVVTTS
Download sequence
Identical sequences A0A080UMC3 A0A0H3E6R0
WP_003328057.1.100936 WP_003328057.1.10353 WP_003328057.1.15971 WP_003328057.1.16994 WP_003328057.1.32777 WP_003328057.1.39473 WP_003328057.1.39900 WP_003328057.1.40255 WP_003328057.1.59507 WP_003328057.1.62747 WP_003328057.1.68581 WP_003328057.1.69262 WP_003328057.1.70004 WP_003328057.1.72589 WP_003328057.1.72801 WP_003328057.1.7305 WP_003328057.1.7508 WP_003328057.1.79721 WP_003328057.1.99425 gi|311070985|ref|YP_003975908.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]