SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|311070987|ref|YP_003975910.1| from Bacillus atrophaeus 1942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|311070987|ref|YP_003975910.1|
Domain Number 1 Region: 3-191
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.68e-41
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00099
Further Details:      
 
Domain Number 2 Region: 145-308
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.54e-29
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0011
Further Details:      
 
Domain Number 3 Region: 618-742
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 3.27e-17
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0029
Further Details:      
 
Domain Number 4 Region: 493-604
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 6.87e-17
Family Duplicated SiR/NiR-like domains 1 and 3 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|311070987|ref|YP_003975910.1|
Sequence length 770
Comment assimilatory nitrate reductase electron transfer subunit [Bacillus atrophaeus 1942]
Sequence
MNKQTLILIGNGMAGVRCIEEIVKLDSSAFEIVIIGSEPHVNYNRIRLSSVLQGEASLDE
ITLNNSNWYATHGITLYTGETVVDIDTDKQIVSTDQKRSLSYDKLIVATGSTPYILPIPG
HDKEGVYSFRTIEDCQSFIKIARHYQKAAVIGAGILGLEAAIGLKNLGMDVNVIHHSFSI
MQKQLDQTASHMLKSALERKGLAFLLQKDTEAILGNSRASGVRFTDGSSIEADLIVMAAG
VRPNIQLAASAGISTNRGIIVNEYMQTNMPNVYAVGECAEHNGIVYGLVAPLYEQGKALA
THICGVLGEGYQGTPQSAALKIAGIEVWSAGKVHADETTTSIQLYDEQAGIYKKALFQDD
KLSGVILFGDTRDKQQLLDSLLKQRDISIVKKQLIEPNQTANVFESMPSSETICQCNSVT
KGSMMEAVNTKGLKTVEEVRNCTKASGSCGGCKPLVEELLAYVLSGEHTEKAGKPPFCGC
TGFTEEEIIAELQRRPFTAPAEVMNHLGWKTENGCQTCIPAIQYYLGMIRPDLVQNHETA
MKKGDTCTLIPQMYGGLTNAEELRRIADIIEIYNIPSVSITHSQRLRLSGIKPDDLPNIR
QALQMPICSNHHYTVHSVTSCTCGQNSSFQTLAGSIEKKIENLSMPAPVSISLSCEKDCE
DAAIQDIGAIQIYGGWDIYAGGRRGTHAHAGELLCVTENQKDTAAMIKCLLQYYRETANY
SEALHQWMSRLGIIHIREILFDQDLRIQLLKSLETDVSLIQNPLTHVKRS
Download sequence
Identical sequences A0A080UH14 A0A0H3E9H5
WP_003328059.1.100936 WP_003328059.1.10353 WP_003328059.1.15971 WP_003328059.1.16994 WP_003328059.1.32777 WP_003328059.1.39900 WP_003328059.1.40255 WP_003328059.1.59507 WP_003328059.1.62747 WP_003328059.1.68581 WP_003328059.1.69262 WP_003328059.1.70004 WP_003328059.1.72589 WP_003328059.1.72801 WP_003328059.1.7305 WP_003328059.1.7508 WP_003328059.1.79721 WP_003328059.1.99425 gi|311070987|ref|YP_003975910.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]