SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|311067401|ref|YP_003972324.1| from Bacillus atrophaeus 1942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|311067401|ref|YP_003972324.1|
Domain Number 1 Region: 17-200
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.96e-47
Family Methylesterase CheB, C-terminal domain 0.00033
Further Details:      
 
Domain Number 2 Region: 276-471
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.88e-45
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.00048
Further Details:      
 
Domain Number 3 Region: 1021-1179
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 5.63e-37
Family Histidine kinase 0.0023
Further Details:      
 
Domain Number 4 Region: 846-956
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 6.81e-20
Family Flavin-binding PAS domain 0.022
Further Details:      
 
Domain Number 5 Region: 965-1029
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000000001
Family Homodimeric domain of signal transducing histidine kinase 0.0021
Further Details:      
 
Domain Number 6 Region: 205-278
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.00000000144
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0071
Further Details:      
 
Domain Number 7 Region: 736-840
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000436
Family Heme-binding PAS domain 0.033
Further Details:      
 
Weak hits

Sequence:  gi|311067401|ref|YP_003972324.1|
Domain Number - Region: 643-727
Classification Level Classification E-value
Superfamily Tropomyosin 0.00392
Family Tropomyosin 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|311067401|ref|YP_003972324.1|
Sequence length 1182
Comment signal transduction histidine kinase with CheB and CheR activity [Bacillus atrophaeus 1942]
Sequence
MQEELMEVSPIDIAKQKPAIIGIGASAGGLNAVKEFFKAFKSSLNVCFVVVQHLSAKYKS
FMPELLGKYTSMDVRLARNGETLKGKTVYLCPPNHNIKIENHTIQVHTYDENEKINYPID
YFLKSLALSQREKAIAIILSGKGRDGAEGMKLIHEQGGICMAQDESAQCPDMPNHVIKSG
IADFVERPKKIAAYMNQLLNQVKCKLSDEAVEKTIYLIQKQTGIDFSMYKKNSVSRRIER
RMNLLDEQMLSLDEYNRYVMKHPEELQLLFNDLLIGVTHFFRDKESFDTLRKHFVPAIVE
NNIKKGRKSCRVWVAGCSTGEEAYSVAMVFCEEIEKRKAAIDLQIFATDINKSSIQKASK
GTYTEQAVSPVPPEWLVKYFEKKGPNYVVKKRLREHVVFAPHNVIKDSPFVDLDFISCRN
VMIYFQQEFQEKVLSLFHFALREEGYLMLGPSETIGKMTNLYTPANRKWKVFSNSTSAEQ
IKYHLSEAAHAERKHEQAGKCNKIYELMEFHQMDEMYLSLIDQYLHPCMILNDREEIIAS
SESANQYLKFPNGKCNYSIYNIFPTNLSVPISTALKKARATNTEVKFQNMKVSVGGKPTH
VELTLKSLKRNHYQLYILFIENKKYKREKSAKHELLMFDEDSAYHQRILDLEKELYETKQ
HLQTAIEKLETSNEELQSTNEELIAANEELQSTNEEMQSVNEELMTVNQQFEKKIEELTA
MTTDMDNLLINTNIATIFLDEQCHIKLFTPEAENVFHLIERDIGRPIYHISSRLKYENYF
EDIQLTLKDKRFIQKEVEAQNGDWYNVKMMPYYTNENKVEGVVITFVNITDLKSTNKALQ
ISSEAVEQSPANILIAAADGQIKYVNKRFCEMIGKEQYEIIGENVFELYDQYFQLSELSS
HWHSIPENNRWSGELYYQDKDGLDRWEYVTLLPVKDDSGQVGRIMRIAEDITNQKQSEKM
LMKSEMLSAIGQLAAGIAHEIRNPLTSLKGFLQLMIQSKKYQKDYAEVMMSEFVRLESII
NEFLVLSRSKSVQFETIQINDIVEDVSLILESQAMLKGVRVIKNLNDKLPDIKGVPNELK
QVFLNVLKNAIESMEQIEGDIHIHTVYQNGYIQLTFEDQGKGISKEMMERLGEPFYTTKE
KGTGLGLMVSFKIIESHKGTIEFESIENQGTKVTIKLPVSKK
Download sequence
Identical sequences A0A080UIT8 A0A0H3DZB8
WP_013390451.1.100936 WP_013390451.1.10353 WP_013390451.1.15971 WP_013390451.1.16994 WP_013390451.1.32777 WP_013390451.1.39900 WP_013390451.1.40255 WP_013390451.1.59507 WP_013390451.1.62747 WP_013390451.1.68581 WP_013390451.1.69262 WP_013390451.1.70004 WP_013390451.1.72801 WP_013390451.1.7305 WP_013390451.1.7508 WP_013390451.1.79721 WP_013390451.1.99425 gi|311067401|ref|YP_003972324.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]