SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|347538299|ref|YP_004845723.1| from Pseudogulbenkiania sp. NH8B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|347538299|ref|YP_004845723.1|
Domain Number 1 Region: 239-371
Classification Level Classification E-value
Superfamily Cell-division protein ZipA, C-terminal domain 7.19e-27
Family Cell-division protein ZipA, C-terminal domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|347538299|ref|YP_004845723.1|
Sequence length 388
Comment ZipA FtsZ-binding region [Pseudogulbenkiania sp. NH8B]
Sequence
MSELQIGLLALGAAVVGLVYGFNVLQEWRFRKKTRQAFARHHDDVLLNVPKNNVRDGVKA
TRLEPVLVDAAGADNEPEAPGFEPELPPLDPHDIPELPRLDDDIDLEEETDFAFDSADHQ
ALVVAMLDPSLDFIAEVVFHQSHELAAMPRFNVAKRVQIIGRTEKGLWKPAEILPGTRYK
QLNIGLQLVDRGGAVTEQELASFCQQVSRFADEHNAAVSFPQRQQKLVAARELDRFCSEV
DMLIGINIVPRQPIDGARLRSFSEAGGLQLEPDGAFHYLADSGNSLYSLAAADQTPFSYH
NLLDHSFAALTLLFDVPRVAGGVEVFDRALEFAQQLAHEFDAQLVDDNHRVLSDVGLTRI
RDQLQHIYGSMDDRGIAPGSVAALRLFA
Download sequence
Identical sequences G2IWF4
gi|347538299|ref|YP_004845723.1| WP_014085833.1.76262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]