SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|347538639|ref|YP_004846063.1| from Pseudogulbenkiania sp. NH8B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|347538639|ref|YP_004846063.1|
Domain Number 1 Region: 120-284
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 2.88e-46
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00055
Further Details:      
 
Domain Number 2 Region: 409-549
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 2.88e-41
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0014
Further Details:      
 
Domain Number 3 Region: 1-125
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 3.27e-29
Family Duplicated SiR/NiR-like domains 1 and 3 0.012
Further Details:      
 
Domain Number 4 Region: 252-276,315-421
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.8e-23
Family Duplicated SiR/NiR-like domains 1 and 3 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|347538639|ref|YP_004846063.1|
Sequence length 552
Comment sulfite reductase (NADPH) hemoprotein subunit beta [Pseudogulbenkiania sp. NH8B]
Sequence
MYRYDEVDYRIVRERVAQFRDQTRRFLAGELSEDEFRPLRLMNGLYIQRHAPMFRIAIPY
GHLASRQLRKLAHIARTYDKGYGHFTTRQNMQFNWPALERVPDILSELADVEMHSIQTSG
NCVRNTTTDAFAGVAADELIDPRPYCEIIRQWSTLHPEFAFLPRKFKIAVSGSVDDRAAT
LVHDVGLHVVRAADGEIGFKVIVGGGLGRTPIVGEVIREFLPTRHILTYLDAILRVYNRY
GRRDNKFKARIKILVKALTPQGFAAKVEDEWLHLKDGAATLRDEDVAHYASFFGAPAYET
LSPNPEAFTAKLAEDRAFARWVEQNTRTHRQPGYRSVVLSLKKTGVPPGDITAEQMEAVA
DWSERFGFGEVRVAHEQNVILPDIKESDLYEVWQLARSQGFATPNIGLLTDIICCPGGDF
CSLANARSIPVAEAIQRKFDDLDYLHDLGEIDCNFSGCMNACGHHHIGNIGILGVDKNGE
EWYQITLGGSQGNHTAIGKVIGPSFAQADVPLAFEKIMNLYVEQRQDGERFIETVRRIGL
EPFKERVYAKHH
Download sequence
Identical sequences G2IYP6
WP_014086112.1.76262 gi|347538639|ref|YP_004846063.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]