SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|86610011|ref|YP_478773.1| from Synechococcus sp. JA-2-3B'a(2-13)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|86610011|ref|YP_478773.1|
Domain Number 1 Region: 2-113
Classification Level Classification E-value
Superfamily RbcX-like 1.57e-43
Family RbcX-like 0.00000803
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|86610011|ref|YP_478773.1|
Sequence length 135
Comment chaperon-like protein RbcX [Synechococcus sp. JA-2-3B'a(2-13)]
Sequence
MDLKQIAKDTAKTLISYLTYQAMRTVLAQLSETDPPRALWLQQFSARQNLQDGEAYLRAL
LAERPELAYRIMTVREHIAAEVVDYLPEMAKAGIQQANMEHRRNHLERITSATGSLPVTH
PEAGSPPQNPRLETE
Download sequence
Identical sequences Q2JIP4
WP_011434137.1.34384 321332.CYB_2578 2013536444 2010232187 gi|86610011|ref|YP_478773.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]