SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|525673728|ref|YP_008225050.1| from Mycobacterium tuberculosis EAI5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|525673728|ref|YP_008225050.1|
Domain Number 1 Region: 197-320
Classification Level Classification E-value
Superfamily Duplicated hybrid motif 5.36e-48
Family Peptidoglycan hydrolase LytM 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|525673728|ref|YP_008225050.1|
Sequence length 332
Comment membrane protein [Mycobacterium tuberculosis EAI5]
Sequence
MAAIRTPRDRWPHHHRNEVTEIIPLDGFLDGLALYDELDFAELDDLDLGDDCVFDYEAQL
LAAPELDDLDDADDLAPEWLVAPTVVLTPGVTPVSRRVGQHRKQPIGAARGRLLISAMAA
GAAAAAAHTAIQQSETPRTETVLTAHASALNEGSGSNPPRGVQVIAAQPAASAAVHNAEF
ARGVAFAEERAEREARLQRPLYVMPTKGIFTSSFGYRWGVLHAGIDLANAIGTPIYAVSD
GVVIDAGPTAGYGMWVKLLHADGTVTLYGHVNTTLVSVGERVMAGDQIATMGSRGFSTGP
HLHFEVLLGGTERVDPVPWLAKRGLSVGNYTG
Download sequence
Identical sequences gi|525673728|ref|YP_008225050.1| WP_003904512.1.100337 WP_003904512.1.100682 WP_003904512.1.10414 WP_003904512.1.10421 WP_003904512.1.11141 WP_003904512.1.11491 WP_003904512.1.11984 WP_003904512.1.12130 WP_003904512.1.12424 WP_003904512.1.13302 WP_003904512.1.13526 WP_003904512.1.14341 WP_003904512.1.15372 WP_003904512.1.16055 WP_003904512.1.16110 WP_003904512.1.16426 WP_003904512.1.17167 WP_003904512.1.18013 WP_003904512.1.19063 WP_003904512.1.19512 WP_003904512.1.20028 WP_003904512.1.20268 WP_003904512.1.20273 WP_003904512.1.20432 WP_003904512.1.20916 WP_003904512.1.2137 WP_003904512.1.22305 WP_003904512.1.22356 WP_003904512.1.22445 WP_003904512.1.22490 WP_003904512.1.22589 WP_003904512.1.22674 WP_003904512.1.22963 WP_003904512.1.24128 WP_003904512.1.24414 WP_003904512.1.24629 WP_003904512.1.24907 WP_003904512.1.25252 WP_003904512.1.25283 WP_003904512.1.25853 WP_003904512.1.26234 WP_003904512.1.26798 WP_003904512.1.27004 WP_003904512.1.27803 WP_003904512.1.28682 WP_003904512.1.28758 WP_003904512.1.29078 WP_003904512.1.29102 WP_003904512.1.29223 WP_003904512.1.29399 WP_003904512.1.2949 WP_003904512.1.29742 WP_003904512.1.30224 WP_003904512.1.30745 WP_003904512.1.33035 WP_003904512.1.33168 WP_003904512.1.33906 WP_003904512.1.3399 WP_003904512.1.34131 WP_003904512.1.34153 WP_003904512.1.35146 WP_003904512.1.35811 WP_003904512.1.35897 WP_003904512.1.35923 WP_003904512.1.3593 WP_003904512.1.36156 WP_003904512.1.36270 WP_003904512.1.36844 WP_003904512.1.36951 WP_003904512.1.38380 WP_003904512.1.38384 WP_003904512.1.38535 WP_003904512.1.38539 WP_003904512.1.38659 WP_003904512.1.38865 WP_003904512.1.39211 WP_003904512.1.40029 WP_003904512.1.40852 WP_003904512.1.40948 WP_003904512.1.41296 WP_003904512.1.41616 WP_003904512.1.42075 WP_003904512.1.44041 WP_003904512.1.44464 WP_003904512.1.44519 WP_003904512.1.44526 WP_003904512.1.44589 WP_003904512.1.44767 WP_003904512.1.45066 WP_003904512.1.45783 WP_003904512.1.45884 WP_003904512.1.46402 WP_003904512.1.46463 WP_003904512.1.46674 WP_003904512.1.46897 WP_003904512.1.47012 WP_003904512.1.48450 WP_003904512.1.49111 WP_003904512.1.49516 WP_003904512.1.49588 WP_003904512.1.50642 WP_003904512.1.52038 WP_003904512.1.52791 WP_003904512.1.53204 WP_003904512.1.53302 WP_003904512.1.53822 WP_003904512.1.54347 WP_003904512.1.55504 WP_003904512.1.55807 WP_003904512.1.56534 WP_003904512.1.56709 WP_003904512.1.57151 WP_003904512.1.57314 WP_003904512.1.57352 WP_003904512.1.5758 WP_003904512.1.57617 WP_003904512.1.57930 WP_003904512.1.58202 WP_003904512.1.58939 WP_003904512.1.58941 WP_003904512.1.59316 WP_003904512.1.59856 WP_003904512.1.60007 WP_003904512.1.60016 WP_003904512.1.60479 WP_003904512.1.60870 WP_003904512.1.61494 WP_003904512.1.61979 WP_003904512.1.62408 WP_003904512.1.62786 WP_003904512.1.6314 WP_003904512.1.63154 WP_003904512.1.63166 WP_003904512.1.6322 WP_003904512.1.63247 WP_003904512.1.64119 WP_003904512.1.64223 WP_003904512.1.64514 WP_003904512.1.64802 WP_003904512.1.64937 WP_003904512.1.66229 WP_003904512.1.66615 WP_003904512.1.67170 WP_003904512.1.67354 WP_003904512.1.67481 WP_003904512.1.67516 WP_003904512.1.68164 WP_003904512.1.68484 WP_003904512.1.68624 WP_003904512.1.69008 WP_003904512.1.69925 WP_003904512.1.70505 WP_003904512.1.70955 WP_003904512.1.71026 WP_003904512.1.72128 WP_003904512.1.7216 WP_003904512.1.72973 WP_003904512.1.7298 WP_003904512.1.73150 WP_003904512.1.73986 WP_003904512.1.74120 WP_003904512.1.74401 WP_003904512.1.75250 WP_003904512.1.75281 WP_003904512.1.75645 WP_003904512.1.75811 WP_003904512.1.76007 WP_003904512.1.76280 WP_003904512.1.76521 WP_003904512.1.76639 WP_003904512.1.76881 WP_003904512.1.77252 WP_003904512.1.77280 WP_003904512.1.7740 WP_003904512.1.77605 WP_003904512.1.77726 WP_003904512.1.78084 WP_003904512.1.78793 WP_003904512.1.79077 WP_003904512.1.79198 WP_003904512.1.79273 WP_003904512.1.79802 WP_003904512.1.80015 WP_003904512.1.80300 WP_003904512.1.80351 WP_003904512.1.80399 WP_003904512.1.81505 WP_003904512.1.81809 WP_003904512.1.8217 WP_003904512.1.82462 WP_003904512.1.82973 WP_003904512.1.83110 WP_003904512.1.83648 WP_003904512.1.84186 WP_003904512.1.84408 WP_003904512.1.85041 WP_003904512.1.85346 WP_003904512.1.85464 WP_003904512.1.85597 WP_003904512.1.86024 WP_003904512.1.8666 WP_003904512.1.87001 WP_003904512.1.87369 WP_003904512.1.87404 WP_003904512.1.87406 WP_003904512.1.87955 WP_003904512.1.88180 WP_003904512.1.88521 WP_003904512.1.89193 WP_003904512.1.89567 WP_003904512.1.90439 WP_003904512.1.91043 WP_003904512.1.91265 WP_003904512.1.91352 WP_003904512.1.91713 WP_003904512.1.91978 WP_003904512.1.92021 WP_003904512.1.94602 WP_003904512.1.96166 WP_003904512.1.96235 WP_003904512.1.96575 WP_003904512.1.97127 WP_003904512.1.97223 WP_003904512.1.9739 WP_003904512.1.98181 WP_003904512.1.98850 WP_003904512.1.99117 WP_003904512.1.99205 WP_003904512.1.99404 WP_003904512.1.99832 WP_003904512.1.9993 WP_003904512.1.99982 gi|386003956|ref|YP_005922235.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]