SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|332669204|ref|YP_004452212.1| from Cellulomonas fimi ATCC 484

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332669204|ref|YP_004452212.1|
Domain Number 1 Region: 174-283
Classification Level Classification E-value
Superfamily OmpA-like 6.28e-24
Family OmpA-like 0.0028
Further Details:      
 
Weak hits

Sequence:  gi|332669204|ref|YP_004452212.1|
Domain Number - Region: 56-158
Classification Level Classification E-value
Superfamily Phase 1 flagellin 0.0641
Family Phase 1 flagellin 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|332669204|ref|YP_004452212.1|
Sequence length 301
Comment OmpA/MotB domain-containing protein [Cellulomonas fimi ATCC 484]
Sequence
MSSHGGRRRSRGGHEEEHVNHERWLVSYSDMITVLMALFIVLFAISQVDQEKYIALRDSL
AAGFMDTTTSPSVLDGTDGTLDGKSTQSENTPADGTAGMVSADDGLGQQAAVPPVPATPT
TDASVDPATLAAAQAEAAHLTELRDRIAQALAANGLDQAVRMRIDERGLVLGLVADDVFF
APARAELTDTARRVLDVASPLIVGIGENVSVEGHANVIPVSGRYPTNWELSADRATQVLR
HLVEVDGMPGPRIMAVGFGDTRPLVAGDSPEALAANRRVDLVILSAAPEQVRALLPSLTG
G
Download sequence
Identical sequences F4GYV6
gi|332669204|ref|YP_004452212.1| WP_013769854.1.46799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]