SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|332669558|ref|YP_004452566.1| from Cellulomonas fimi ATCC 484

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332669558|ref|YP_004452566.1|
Domain Number 1 Region: 4-182
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 1.1e-43
Family Phosphoglucomutase, first 3 domains 0.00035
Further Details:      
 
Domain Number 2 Region: 159-257
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 1.57e-28
Family Phosphoglucomutase, first 3 domains 0.00063
Further Details:      
 
Domain Number 3 Region: 259-365
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 2.12e-28
Family Phosphoglucomutase, first 3 domains 0.0055
Further Details:      
 
Domain Number 4 Region: 360-447
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 3.4e-20
Family Phosphoglucomutase, C-terminal domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|332669558|ref|YP_004452566.1|
Sequence length 449
Comment phosphoglucosamine mutase [Cellulomonas fimi ATCC 484]
Sequence
MTRLFGTDGVRGLANRDVTAELALDLSVAAAHVLGASGAFEGHRPRAVVGRDSRASGEFL
AAAVAAGLASAGVDVVNVGVLPTPAVAYLTAQLEVDLGVVLSASHNPMPDNGIKFLARGG
HKLDDELERAIEARMGEAWDRPVGADVGRIRLDTGRAGDDYVEHLVSTIGVSLEGLRIAV
DCANGAASDVGPAALREAGADVVVINASPDGRNINEKCGSTHPEQLLAAVVASEADLGVA
FDGDADRCLAVDADGRLVDGDQIMGVLALAMRDAGTLVDDTLVTTVMSNLGLRLAMRDHG
VRTVETAVGDRYVLEAMRAGGYALGGEQSGHIIMAAHATTGDGVLTALQLAARVAATGEP
LAKLAGIVQRLPQTLVNVAGVDKARAGSDVPLLEAVRAAEARLGDTGRVLLRPSGTEPLV
RVMVEAGTQQDADAVARELAGVVSDRLAL
Download sequence
Identical sequences F4H209
gi|332669558|ref|YP_004452566.1| WP_013770205.1.46799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]