SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|332670477|ref|YP_004453485.1| from Cellulomonas fimi ATCC 484

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332670477|ref|YP_004453485.1|
Domain Number 1 Region: 1-204
Classification Level Classification E-value
Superfamily Formyltransferase 8.24e-58
Family Formyltransferase 0.00000508
Further Details:      
 
Domain Number 2 Region: 204-308
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 1.65e-21
Family Post formyltransferase domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|332670477|ref|YP_004453485.1|
Sequence length 312
Comment methionyl-tRNA formyltransferase [Cellulomonas fimi ATCC 484]
Sequence
MRLLFAGTPAAAVPSLEALLASRHEVVAVLTRPDARAGRGRTLAPSPVKARALEAGIEVL
TPARPRGEEFVARLAELDVDAAPVVAYGALLPAEVLDVPRHGWVNLHFSVLPAWRGAAPV
QHALIAGDEVTGATTFRIEQGLDTGPVLGTLTETVRPRDTAGDLLTRLATSGAGLLVATL
DALEDGELVAVPQPADGVSHAPKIEAEDARVRWSHPVHAVDRRIRGCTPAPGAWTTLPDG
ARLGLGPVLPRPDVTELAPGELRAGRREVLVGAGGGAVQLGDVTPPGKRAMPAADWARGA
RPADGTVLGGAA
Download sequence
Identical sequences F4GZQ4
WP_013771124.1.46799 gi|332670477|ref|YP_004453485.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]