SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319956238|ref|YP_004167501.1| from Nitratifractor salsuginis DSM 16511

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319956238|ref|YP_004167501.1|
Domain Number 1 Region: 6-385
Classification Level Classification E-value
Superfamily Homocysteine S-methyltransferase 2.35e-101
Family Homocysteine S-methyltransferase 0.00000778
Further Details:      
 
Domain Number 2 Region: 872-1168
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 1.57e-78
Family Methionine synthase SAM-binding domain 0.0015
Further Details:      
 
Domain Number 3 Region: 343-605
Classification Level Classification E-value
Superfamily Dihydropteroate synthetase-like 1.11e-70
Family Methyltetrahydrofolate-utiluzing methyltransferases 0.00016
Further Details:      
 
Domain Number 4 Region: 716-847
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-binding domain 4.71e-38
Family Cobalamin (vitamin B12)-binding domain 0.0001
Further Details:      
 
Domain Number 5 Region: 628-714
Classification Level Classification E-value
Superfamily Methionine synthase domain 3.4e-21
Family Methionine synthase domain 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|319956238|ref|YP_004167501.1|
Sequence length 1168
Comment methionine synthase (b12-dependent) [Nitratifractor salsuginis DSM 16511]
Sequence
MKPADRIREIIAERYLVIDGAMGTQIQDLKVPAEAWLDEKGESQEGCNELLNATAPELIG
RIHKRYAMAGADMIKTNTFGAMPWVLDEYGLGERAYELSRKGAELVKAVCEEYSTPEKPR
FVLGSIGPGTKLPSLGHIDYEAMYEGYLETARGLIDGGCDVFLLETCQDPLQIKAALHAC
EAANAEKSASLPIMVSVTIELSGSMLIGTDAATIVTILEPFDILSLGFNCGTGPDQVKKH
LKTLSERCKFPISVHSNAGLPQNRGGHTFYPMGPDEFAKKELEFIDFDGVAFLGGCCGTT
PQHIQALAKAIEGKKPKSPTGSIPPSIASLFESVELFQDPAPLLIGERSNATGSKAFRQL
ILDEDYEGTLTVAQEQVRAGAHALDVNVEFAGRDGAKDMKEVISLYNQKIPIPLMPDATN
VHTMEVGLRRIGGRPIINSANLEDGIERFDRICRLAKKYGAALVLLTIDETGMAKEKERK
VEVAERMIERAVNLHGLRKEELIVDVLTFTVGSGDEEYRDAAVQTLEAIRELHKRHPELG
TTLGLSNISFGLAPHARVYLNSVFLHHCVEAGLSSVIINVKHIVPLSRMSEEDIAVCEEL
LFHADENSLFRFIEHFSDKSLETEQTDEEYEKLSTEEKIQKLLMDGDKERLIPLVEEARH
ELGADRIVNEILIDGMKVIGELFGSGQMQLPFVLQSAETMKATVDYLNPYLTKQEKESDT
TLVIGTVKGDVHDVGKNLVDIILSNNGFKVKNIGIKVELEQFLEAYEEVNADAIGMSGLL
VKSTQVMKENLEELARRGIEIPIIMGGAALTRGFVDDYCRPIYKGPIFYCRDAFDGVVAM
SRIEEWKKDPSKPLDTRMAGDMNERVVKEKKEVVIPPFEEIKMPKPVEIPTPPFWGRRVM
DRENLDLSMIFDWVNKRTLFKMHWGYKSKGMSKEEYQKLLDKTVYPAWERLKDTFLKEKL
FEPTILYGYYPCRSDDQELFLFSPDEGWFSESEVNREPLEEIVGRAVGVFNFPRQRRKPY
RALSDFFRHERHDVVALTCVSAGPKITEYERALYEKGEYLEYNLVHGLGVELAEALAEVA
HKQIRLDLGIASEDEGHTLRDVRMNRYRGARYSFGYAACPDLEQSRVIFDLLEPEEFGIE
LSETFQIHPEQSTTAIVVHHPEATYYAV
Download sequence
Identical sequences E6X0N2
WP_013553448.1.35362 gi|319956238|ref|YP_004167501.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]