SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319956251|ref|YP_004167514.1| from Nitratifractor salsuginis DSM 16511

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319956251|ref|YP_004167514.1|
Domain Number 1 Region: 50-519
Classification Level Classification E-value
Superfamily Nitrous oxide reductase, N-terminal domain 4.05e-82
Family Nitrous oxide reductase, N-terminal domain 0.000000881
Further Details:      
 
Domain Number 2 Region: 480-657
Classification Level Classification E-value
Superfamily Cupredoxins 2.55e-26
Family Nitrosocyanin 0.0016
Further Details:      
 
Domain Number 3 Region: 766-863
Classification Level Classification E-value
Superfamily Cytochrome c 0.0000000000000151
Family monodomain cytochrome c 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|319956251|ref|YP_004167514.1|
Sequence length 868
Comment nitrous oxide reductase apoprotein [Nitratifractor salsuginis DSM 16511]
Sequence
MNSMVKRLSLAAIGALVGVSMVSADNSELEKVMKERGLTQQDLLAAAKTYTPSGGRDKYI
VFSSGGQSGQMLVYGVPSMRILKYIGVFTPEPWQGWGYDDDTKKILAEGKIRGKQITWGD
THHPALSETNGRYDGKWLVINDKANPRIAVIDLNDFVTKQIVVNPLFKSDHGGAFFTPNS
EYILEACQYAAPLDNNWHPMSEYKETYRGGVTVWKFDPKIGRILPDKSFTIEFPPYMQDL
SDAGKEASYGWGFTNSFNSEMYTGGIEKGLPPFEAGCSRNDTDFLHVYNWKKLAELAKDP
KNVKVINGMRVVPIDVAVKNNALFLIPEPKSPHGVDVSPDGKYIVVCGKLDTHATVYSWD
KIQKAIKNKDFVGKDPYGIPIIDMKKAMHCQAELGLGPLHNQFGKHWKKQGEIYTSLYVD
SQVVKWNYLTCKVEDRQNVNYNIGHLCGMEGKTEDPQGDYIIALNKLAIDRFNEIGPLHP
QNHQLIDIRGKKMQLLYDMPIPLGEPHQAVAIRASKLKPEVRYKMGTNPFTGKPHRGKTL
AGQEHIERKGNHVYVYGTMVRSHINPEHVNVNLGDTVTFYLTNLERAEDETHGFTVDQYN
VHASLEPGKTVALTFKADREGVFPYYCTEFCSALHLEMMGYLLVKDPNKHYVSAKKLKMA
KMSKEQLEKEYEKIVATNKATDKVIQSVVKFLKENHYEKYPVVKQLVEDALDQYSKIPEQ
QKKAEEAYKKGDLEKAILFQNMVWQYMVKTADVGIRARDLLVKKLATPMSEAARRGHEAY
LEGGCNGCHVIGKVSSGPDLVGVLQRHKNGEKWVKEWILHPEKMYNNPYIKSMTNYFNLR
MPNQGMTEKQVDDIIEYLKWIDKNANLF
Download sequence
Identical sequences E6X0P5
gi|319956251|ref|YP_004167514.1| WP_013553461.1.35362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]