SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319957001|ref|YP_004168264.1| from Nitratifractor salsuginis DSM 16511

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319957001|ref|YP_004168264.1|
Domain Number 1 Region: 5-306
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1.67e-48
Family Methylenetetrahydrofolate reductase 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|319957001|ref|YP_004168264.1|
Sequence length 307
Comment methylenetetrahydrofolate reductase [Nitratifractor salsuginis DSM 16511]
Sequence
MFDTFCQNLQGTSPFITVEITPPHGASMDPILEAIEASGLVQKKISGFSVTDNPLARLKM
SAILSAIRVQQRFGKPVIATMSMRDRNKLSLQSSLLGANDFDIRLILALTGDPAKFSDQP
EVKGVLERDSTLLLSIIYRLNNGYDYSGQELDPKPRPIYPFAVSNAYAKDMKQLMKRMVK
KLDYGARAIITQPVFDLDNARELLEIFEEAKGKSIRETAKEARLILGQFPIVRARTATFI
DDKVPGIHVPKRIIDEMNLAAMDGVEKEQEVGFTLSKRIFDEIMALHPKVHLMTHNRFEL
CAKLIER
Download sequence
Identical sequences E6WYS9
WP_013554206.1.35362 gi|319957001|ref|YP_004168264.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]