SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319957114|ref|YP_004168377.1| from Nitratifractor salsuginis DSM 16511

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|319957114|ref|YP_004168377.1|
Domain Number - Region: 38-86
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 0.0981
Family Proline dehydrohenase domain of bifunctional PutA protein 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|319957114|ref|YP_004168377.1|
Sequence length 206
Comment hypothetical protein Nitsa_1377 [Nitratifractor salsuginis DSM 16511]
Sequence
MDLERVERELRKRLDYPYRWGKKQSDDWDNRTNFIYTTYSFRRLLERTAAFDGALRDYAL
NRWYNFWSAKAVEYIFSLHGNVEPNINKYDKRVDFYIEGIPFDHKTSVFPKGFKRSYAYA
RAHEEELIYWLYMNQSQEKRKHLKNRLFVILYDGKDMQHWKLKAYIGFLKHKIDTYMGHF
SKNNLHIFDFGEGRVYSDILWVYRDK
Download sequence
Identical sequences E6WZB6
gi|319957114|ref|YP_004168377.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]