SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319956085|ref|YP_004167348.1| from Nitratifractor salsuginis DSM 16511

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319956085|ref|YP_004167348.1|
Domain Number 1 Region: 43-194
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.43e-46
Family Myf domain 0.0018
Further Details:      
 
Domain Number 2 Region: 458-676
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 5.59e-32
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00075
Further Details:      
 
Domain Number 3 Region: 682-778
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 2.62e-19
Family Anticodon-binding domain of PheRS 0.0018
Further Details:      
 
Domain Number 4 Region: 394-466
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000000000000256
Family Domains B1 and B5 of PheRS-beta, PheT 0.0036
Further Details:      
 
Domain Number 5 Region: 234-362
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.00000392
Family B3/B4 domain of PheRS, PheT 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|319956085|ref|YP_004167348.1|
Sequence length 778
Comment phenylalanyl-tRNA synthetase subunit beta [Nitratifractor salsuginis DSM 16511]
Sequence
MIVTRRWLEEYIDLEGISDQALHDTFNSIGLEVDSMQRHTMPEKVVVGRILSCEKHPDAD
KLNLCSVDVGADAPLQIVCGAANVREAEYVAVATVGAVLPGDFAIKPAKLRGVESFGMIC
SSSELGLPEMGKGIIILDKSIGELVPGKPLRDYPDFNDTVIELELTANRGDCLSIRGVAR
DLSAALDRPLVAQPQPKPETLPLGIARIVDLHTHGQIEAELLYDYVEKEALRLPLLIELR
LAYVDAWSESPLASHLAYATHATGVILRAYDAGRLRDGEGRVPLELEETAPGLVEVRSAG
RLLSVVGVTASAEFTADDESRELLLEASYIDPERLVPAVAAAEVKPDALYYRSSRGSEPE
IDLGMDRLMAECSRDGECRVSKTPLRIETDYEARTLAVDTARLNAVIGQEIPLGTVHTIL
KRLGFTIHGGDKERFGVTIPRWRHDIRNIQDIAEEILRIVGINNIEAKPLAFTEANRLTE
SAKRFRIRRDLRQEAVAAGFYEAVTYAFADRKKLEAYGFPVVEASKELLNPIVEEFNTLR
STLTINLLEAAQRNVSYGKRRIPLFEIGSVFDRERREREKMTLLWSGDAEEPDVGNQGKP
PRIDFALFVRKLGSILGEYEMTECRESNGLIHPYQSATILLHGQEAGWVSKLHPSVAEAF
GLEETFLAELDFDALIPPHIDAQPVSNFQGTFKDLSLLVEKELPYGKMKKALESLEEPLL
KRFFPIDRYEDEQLGERKSMTLRFFLQSDEGTLSDEVIEGVMARILETLQSRCGAELR
Download sequence
Identical sequences E6WZU1
gi|319956085|ref|YP_004167348.1| WP_013553295.1.35362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]