SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319957160|ref|YP_004168423.1| from Nitratifractor salsuginis DSM 16511

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319957160|ref|YP_004168423.1|
Domain Number 1 Region: 4-184
Classification Level Classification E-value
Superfamily SIS domain 1.31e-54
Family mono-SIS domain 0.00000239
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|319957160|ref|YP_004168423.1|
Sequence length 188
Comment phosphoheptose isomerase [Nitratifractor salsuginis DSM 16511]
Sequence
MKALIYKSLAAHREALDLLETQMQGSIEAAGRLAIEALKEGKKILLCGNGGSAADAQHIA
AEFTGRFVKERRGLPAVALTTDTSALTAIGNDYGFERIFERQVEALAVEGDLLIAISTSG
NSANVLRALEKANDLGCLTLGLSGRDGGAMNDLCDLNLAVPVEETARIQEMHLLIGHLLC
AMVDENFN
Download sequence
Identical sequences E6WZN3
gi|319957160|ref|YP_004168423.1| WP_013554363.1.35362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]