SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|331695017|ref|YP_004331256.1| from Pseudonocardia dioxanivorans CB1190

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|331695017|ref|YP_004331256.1|
Domain Number 1 Region: 5-86
Classification Level Classification E-value
Superfamily TmoB-like 0.000000000458
Family TmoB-like 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|331695017|ref|YP_004331256.1|
Sequence length 90
Comment hypothetical protein Psed_1156 [Pseudonocardia dioxanivorans CB1190]
Sequence
MSSLAVIGRLEKDAHTRIIDVDTDFTMDQVVEACLAPAVGYQARHPKPGAMLRVRPTTDT
DDADPFPRSMTVAEARLRHFQQIDIYVSDD
Download sequence
Identical sequences F4CTZ5
WP_013673341.1.25045 gi|331695017|ref|YP_004331256.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]