SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|331695408|ref|YP_004331647.1| from Pseudonocardia dioxanivorans CB1190

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|331695408|ref|YP_004331647.1|
Domain Number 1 Region: 6-370
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 1.47e-109
Family FMN-linked oxidoreductases 0.00000000205
Further Details:      
 
Domain Number 2 Region: 337-524
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 1.12e-43
Family N-terminal domain of adrenodoxin reductase-like 0.0000229
Further Details:      
 
Domain Number 3 Region: 466-523,558-653
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.31e-23
Family C-terminal domain of adrenodoxin reductase-like 0.0000933
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|331695408|ref|YP_004331647.1|
Sequence length 675
Comment 2,4-dienoyl-CoA reductase [Pseudonocardia dioxanivorans CB1190]
Sequence
MPDDEAYPHLFTPLDLGFTTLPNRVVMGSMHTGLEDDPAAAPRLAAYFAERARAGVALMV
TGGYAPHANGVLTEGGSLLDDASQLPAHRIVTDAVHEAGGRIALQVLHAGRYSKQPDLVA
PSAIRARINRFVPRPLDEEGIRELIDSYARCAALAREGGYDGIEIMGSEGYLINTFLAPA
TNTRSDDWGGSPENRRRFALEVMRASRAAVGDDFVIIFRLSMADLVPDGQTWDEIVTLAR
GIEDAGATLLNTGIGWHEAQIPTIATSVPRAAFTNVTASLRPHVGIPVITSNRISMPDVA
ERVLAAGHADLVSMARPFLADPEWIRKARAGTPDDINTCIGCNQACLDHIFADKPMSCLV
NPRAGHETELVVLPAPTAKRVAVVGAGPAGLSAAVTAAERGHHVELFESADAIGGQFAIA
SRIPGKEEFSETIRYYRRRLAQLGVTVHLGTRADVRRIVRGGFHEVVLATGVEPRTPDIP
GIDHPMVVSYAEAVLGSPVGKRVAVIGAGGIGVDVSEFLTHVGSPSLDVETWRREWGVAE
PGEVRGSLRPPAPEPSPRRVYLLQRSPGRIGTRLGLTTGWVHRAALAAKGVEQLSGVTYR
RIDDDGVHITDADGAERVLEVDSVVVCAGQEPVRELLDQLRDTGLAVHVIGGADVAAELD
AKRAIDQGTRLAAAL
Download sequence
Identical sequences F4CVH4
gi|331695408|ref|YP_004331647.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]