SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|331696568|ref|YP_004332807.1| from Pseudonocardia dioxanivorans CB1190

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|331696568|ref|YP_004332807.1|
Domain Number 1 Region: 25-301
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 4.4e-60
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0000634
Further Details:      
 
Weak hits

Sequence:  gi|331696568|ref|YP_004332807.1|
Domain Number - Region: 464-534
Classification Level Classification E-value
Superfamily Bacterial luciferase-like 0.0903
Family F420 dependent oxidoreductases 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|331696568|ref|YP_004332807.1|
Sequence length 561
Comment cytochrome b/b6 domain-containing protein [Pseudonocardia dioxanivorans CB1190]
Sequence
MSSITTPTTSSGGLQARAGVALDELDQRFHPAAGLRKQFNKVFPTHWSFMLGEIALYSFI
VLLLSGTYLALFFDPSMTEVTYNGAFDNLRGVHMSKAFESTVTISMDVRGGLFVRQVHHW
AALLFMAAMLVHMFRTFFTGAFRKPRETNWLIGVLLILLGFFEGLTGYSLPDDLLSGTGL
RIMSGITMTAPIIGTWLQWLLFGGEFPGTEIIPRFYILHVLLIPGILLALIAVHVGLVWY
QKHTQFPGPGRTEHNVVGVRILPTFAAKGGAFFAVTVGVIGLMAGLFQINPIWNFGPYDP
SHISAGSQPDWYVLFTEGMARIFPPWELYLGNYTVPAAFWGTAAFLPLPFVVAAIYPAIE
RRFTKDNALHNLLQRPRDAPVRTSLGVMAIAFYGWLVLSGVNDWIAYFFHVSLNATTWAG
RLGLLVVPPIAYWVTYRICIGLQRSDRAVLEHGIETGIIKRLPHGEFIEVHQPLAGVDSH
GHAIPLAYQGAAVPKRMNQLGSAGEAVPGSLLTPDPVEETVALARARAEAHHAELEAIEQ
RSEAPALAGRPDAGRPKDTTD
Download sequence
Identical sequences F4CL25
gi|331696568|ref|YP_004332807.1| WP_013674878.1.25045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]