SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|331697149|ref|YP_004333388.1| from Pseudonocardia dioxanivorans CB1190

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|331697149|ref|YP_004333388.1|
Domain Number 1 Region: 122-365
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 2.17e-41
Family Spermidine synthase 0.0073
Further Details:      
 
Domain Number 2 Region: 8-118
Classification Level Classification E-value
Superfamily S-adenosylmethionine decarboxylase 4.71e-32
Family Bacterial S-adenosylmethionine decarboxylase 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|331697149|ref|YP_004333388.1|
Sequence length 399
Comment S-adenosylmethionine decarboxylase [Pseudonocardia dioxanivorans CB1190]
Sequence
MTGPPAPVGLHVLADLDRIDPAVLDDAAGLRTALADALTAAGATVRQVVAEAFEPHGVTV
VALLSESHASVHTWPEHGRALVDVFTCGDAADPERAVALLATALGGTVRESRTEARGGTP
PVREPIAPGLTRVWDVERPVHRETTPYQRILIAGTAHGVTLFCDDERQSAESTQLVYHEA
LFVPAALLARSRARVLVIGSSEGVVSELALACGAGHVDHVDLDAAAVRACATHLPYGYDE
KALAAAEAHDGPVHVHYADGLQWVRGEGPRYDVIVVDLPDERPDEPDNQLNRLYGRDFLA
DCRDRLAPGGVVVSQAGNPALWRDATLRAAWARFHEVFGDVVYVGSDEHEWSFLLGRAAG
DDAVERMRAALPGLPYRPLSVDDEFLRSRTVPPRRLRTR
Download sequence
Identical sequences F4CX94
gi|331697149|ref|YP_004333388.1| WP_013675455.1.25045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]