SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|331698246|ref|YP_004334485.1| from Pseudonocardia dioxanivorans CB1190

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|331698246|ref|YP_004334485.1|
Domain Number 1 Region: 7-135
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 0.0000000000227
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|331698246|ref|YP_004334485.1|
Sequence length 150
Comment transcription activator effector binding protein [Pseudonocardia dioxanivorans CB1190]
Sequence
MVVEERVEGRPTLVVAALTSPERVSEVWPGLLDEVWALLRSAGVVSGCRNVMLYRDTVAG
LHIEVGVLAPGGVRPSGRVVASGLPAGPVATTVHRGPYTGLGAAHRALGTWCRAAGRQPA
GSRWEVYGPHRDDPAQLSVEVSWLLADVPG
Download sequence
Identical sequences F4CYR2
WP_013676545.1.25045 gi|331698246|ref|YP_004334485.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]