SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|331694497|ref|YP_004330736.1| from Pseudonocardia dioxanivorans CB1190

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|331694497|ref|YP_004330736.1|
Domain Number 1 Region: 102-234
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 3.66e-22
Family GntR ligand-binding domain-like 0.01
Further Details:      
 
Domain Number 2 Region: 10-94
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000000273
Family GntR-like transcriptional regulators 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|331694497|ref|YP_004330736.1|
Sequence length 247
Comment GntR family transcriptional regulator [Pseudonocardia dioxanivorans CB1190]
Sequence
MTDGRAPEARRRKVAEVVARELTLSILDGELPAEAPLPTEREMMDDLGVGRPALREALRL
LEDRGVLEIRLGRNGGPVVRHPGTADFAAPLALVLAFQRATLDDILVAREAIEPAAAGLA
ALRRPDEAVDELRRSAARILEAPDDHDVMLRENAFFHARIADLSGNAVLRVFIDSVKSLL
EDASLTVDYPASRRQALGHAHDAIVESIAVRDAAAATEAMRVHLVEARSYWRDHFPALLD
RTVRQSL
Download sequence
Identical sequences F4CTS4
WP_013672824.1.25045 gi|331694497|ref|YP_004330736.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]