SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|331696966|ref|YP_004333205.1| from Pseudonocardia dioxanivorans CB1190

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|331696966|ref|YP_004333205.1|
Domain Number 1 Region: 187-276
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000157
Family Anti-sigma factor antagonist SpoIIaa 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|331696966|ref|YP_004333205.1|
Sequence length 335
Comment sulfate transporter/antisigma-factor antagonist STAS [Pseudonocardia dioxanivorans CB1190]
Sequence
MTRSTHDVSPGDHVCAVPLSEEQLWEVSADFVADGLDRNEQVLYFDDGTAEGVLGRLADD
HVAVEGPLGTGQLAIVPAETTRAIFHTPLPEAREMMLARIDESAAAGWAGFRMTGQMSYG
VDRQWPTTFVEYDSGLDGLVRDRGITALCLYDRRRYSDEQIERMRDVHRKELSVPTAYDD
GLLRVVRTGLTSARLAGEVDHSNRPAIARLLESTLDDALRSHSAPTEIELNLASLRFIDV
ASAVSLVHAAEGFPDTHRLVLTNVRPGVVRVLDRCGAPFAAQLTVREAPGRSGVPGAIRP
AGGRHRGGGTAGVDADETLPDETLPDDGPALREAR
Download sequence
Identical sequences F4CUG2
gi|331696966|ref|YP_004333205.1| WP_013675273.1.25045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]