SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|331700162|ref|YP_004336401.1| from Pseudonocardia dioxanivorans CB1190

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|331700162|ref|YP_004336401.1|
Domain Number 1 Region: 84-215
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 1.33e-23
Family GntR ligand-binding domain-like 0.019
Further Details:      
 
Domain Number 2 Region: 13-81
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.27e-22
Family GntR-like transcriptional regulators 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|331700162|ref|YP_004336401.1|
Sequence length 245
Comment GntR family transcriptional regulator [Pseudonocardia dioxanivorans CB1190]
Sequence
MVVGTRGVTRVAAPLRMQVVEQLREMIVSGDYGPGDRLVEAPLCEHFGVSRTVVREAIRQ
LESEGLVTIIANRGPVVAELTVTDAQALYEVRASLEGLAGRLFAERAGPEQRAELRSAVE
GVAAAFEQTNLRVRLAAKDRFYEALIDGAGNEIVRQTLRGIHARVQLLRGLSLQAPGRAQ
DSLEELRRIVEAATSGDGEAARLACEDHVRQAGRFAVAMVRDGSGRAPSSGATHGSPSPA
GGGGR
Download sequence
Identical sequences F4CTP5
gi|331700162|ref|YP_004336401.1| WP_013678430.1.25045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]