SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|331701611|ref|YP_004398570.1| from Lactobacillus buchneri NRRL B-30929

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|331701611|ref|YP_004398570.1|
Domain Number 1 Region: 12-335
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 2.28e-94
Family DmpA-like 0.00000234
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|331701611|ref|YP_004398570.1|
Sequence length 369
Comment peptidase S58 DmpA [Lactobacillus buchneri NRRL B-30929]
Sequence
MGLSVELMNDLSDGVKGRRNLITDVGGVKVGQVTIDDGDVHSGVTAILPHTGNLFRHKVP
AASCVLNGFGKSVGLVQIDELGTIETPIVMTNTFGVGTALNALTKQMLAANPEIGDTTST
VNPIVAECNDGDVSNIRKMAITEQNVSDALAAVNDDFEEGAVGSGRGMMCYDLKGGIGSS
SRIVTVDKKHQYTVGALVMTNYGYLTDFIVNGMPIGAPLAKMLAKDKQKEEKGSIITILA
TDAPLNARQLKRMAKRATVGINRSGGYIGNGSGEIVLAFSTANQVDHFETSEFDTVTRFN
DNQIDLFFRATAAVVDESILSSMVHAESVVDRKGRLRLNLVDACKKLISQQPDYTDMVEQ
VFSQLGVVK
Download sequence
Identical sequences F4FWD8
WP_013728054.1.68932 gi|331701611|ref|YP_004398570.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]